close all open/close all
Chth_00420 Chth_00420   last last

CDS information : Chth_00430


close this sectionLocation

Organism
StrainDSM 40725
Entry nameChlorothricin
Contig
Start / Stop / Direction111,967 / 111,482 / - [in whole cluster]
111,967 / 111,482 / - [in contig]
Locationcomplement(111482..111967) [in whole cluster]
complement(111482..111967) [in contig]
TypeCDS
Length486 bp (161 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)tankyrase1-binding protein
Gene
Gene (GenBank)orf39
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in chlorothricin biosynthesis.
Note (GenBank)
  • orf39
Reference
ACC
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [tankyrase1-binding protein]
DPRAGVLEASPGAVGAVDGRPHGERVSWCRAEPDAPQPFVGFVGPRPVEAVQTSLLAVRQ
TVRQVVVAGRLGPEALLCPAPAVCRQRACAAPGRVERRSAPVAAARRGTEVGCRKTLLLA
AHQPQKCRRQRVFGLFGVTVPLSPSGRTRCGPTPCTAPRGR
selected fasta
>hypothetical protein [tankyrase1-binding protein]
GATCCCCGGGCGGGGGTGCTGGAGGCATCACCGGGGGCGGTCGGCGCCGTGGACGGTCGC
CCGCACGGTGAGCGGGTCTCTTGGTGTCGCGCCGAGCCTGACGCCCCTCAGCCGTTCGTT
GGCTTCGTGGGCCCGCGGCCGGTGGAAGCCGTCCAGACGTCGCTCCTCGCCGTCAGGCAG
ACCGTCCGGCAGGTGGTTGTGGCTGGCCGGCTGGGGCCGGAGGCACTGCTGTGTCCGGCC
CCGGCCGTCTGCCGCCAACGGGCGTGTGCCGCCCCGGGCAGGGTCGAGCGCCGGTCCGCG
CCTGTGGCCGCCGCGCGCAGGGGGACAGAGGTGGGCTGCCGGAAGACTCTGCTCCTGGCA
GCCCACCAGCCCCAAAAATGCCGACGGCAGCGGGTTTTCGGACTGTTCGGCGTTACGGTG
CCGCTGTCGCCGTCGGGCCGCACGCGGTGCGGGCCCACTCCTTGTACGGCTCCACGCGGT
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-16]  0.072 Signal
Eukaryota   
TMHMM No significant hit
Chth_00420 Chth_00420   last last