close all open/close all
first first   Conca_00020 Conca_00020

CDS information : Conca_00010


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction3,324 / 559 / - [in whole cluster]
3,324 / 559 / - [in contig]
Locationcomplement(559..3324) [in whole cluster]
complement(559..3324) [in contig]
TypeCDS
Length2,766 bp (921 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)putative LuxR class regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q9ZGI0
NITE
Pikro_00180
PmId
[11344155] Characterization and analysis of the PikD regulatory factor in the pikromycin biosynthetic pathway of Streptomyces venezuelae. (J Bacteriol. , 2001)
[18245260] Enhanced heterologous production of desosaminyl macrolides and their hydroxylated derivatives by overexpression of the pikD regulatory gene in Streptomyces venezuelae. (Appl Environ Microbiol. , 2008)
[26608164] Interspecies Complementation of the LuxR Family Pathway-Specific Regulator Involved in Macrolide Biosynthesis. (J Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [putative LuxR class regulator]
MILIDREEELCALHDFLSESRQGKGHVVLVSGSAGIGKSELLYAFAEEASATGSEVLRAV
GREAERDVPFGVVHQLVRDISLPAPLRTRMTELESSLASGPTAPHESAALQAHVARGLCR
ELLHAAGAGGLVLCVDDIHHADSASLSCLLHLLPHTRSARLMLVLSRPDSARHRPPLLSA
ELLRHPFYRRVRLSPLSLEGTTELTAKTLGTQEAQAHGAVYHSLSGGNPLLVRALLRDHR
DRSADGDAEPEVPSAGEEFAQAVLACLRGGEPLVLGVARTMAVLDSCSSPDRIGRLLHLG
PSSVADALRHVEAAGLVAGGCYRHPAARSAVLDDIPRGVLRRLRLDVAELLHHEGLPTPT
VARHLVAVRHVPACWAVPVLMDASEHARRSGDVGFALECLELALSGSDDVRERALASMML
ARLEWQLNPSTVGPRLGPLSEALLTGVLPAELTVPLSRALLWHGRSDEAAELIRTLGPKA
PGPHGLFPENREWLRNRYPTMVSLLPTAEDGPGGRDGREPATARPVLLAETVLGSTLRNG
GDESSAWSAEQVLRSCGLDEANLYALESALLALVYADRLGQASIWSAKLLQEATVRQVPT
WQAKITAIRAELALRQGDLNEACALARRAMTHLSPRSWGVAVGAPLSTLVLAATAMGADG
VAEEYLRHSVPEAISESRYGLQYLYARGQHHLATNQVHAALDDFLRCGDRARAWDMDLPS
FLPWRSGAAAAHLRLGQRDQVRRLAEAELARPGSAKSRSRGVAMCLLAEIAEPRRRTSLL
LEAVSVLRLAGDRLELARALAALSSAQRAIGEADQARRALYQALHLADVCGAEHLQPSPQ
LRGREETPADPITAPRDPLSAAERRVASLAALGHSNREIADQLCVTISTVEQHLTRVYRK
LNVTRRADLPSEFQTLTAGSV
selected fasta
>putative LuxR family transcriptional regulator [putative LuxR class regulator]
ATGATACTGATCGACCGCGAAGAAGAACTGTGCGCGTTACACGATTTCCTCTCGGAAAGC
CGCCAGGGCAAAGGACACGTCGTCCTCGTCAGCGGCTCCGCGGGCATCGGCAAGTCCGAG
TTGCTCTATGCCTTTGCCGAGGAGGCGTCCGCGACCGGTTCCGAGGTCCTGCGAGCCGTG
GGCAGGGAGGCGGAGCGCGACGTCCCGTTCGGTGTCGTCCACCAACTCGTCCGGGACATC
TCGCTGCCCGCCCCGCTCCGTACGCGGATGACCGAGCTGGAGAGCAGCCTCGCGTCCGGT
CCGACCGCCCCTCATGAGTCGGCCGCGCTGCAGGCTCATGTCGCCCGCGGCCTGTGCCGG
GAGCTGCTGCACGCGGCCGGGGCGGGCGGCCTGGTGCTCTGCGTCGACGACATCCACCAC
GCCGACTCCGCCTCCCTGAGCTGTCTGCTGCACCTGCTCCCCCACACGAGATCCGCCCGT
CTGATGCTGGTGCTCAGCCGCCCGGACAGCGCCCGTCACCGCCCTCCGCTGTTGAGCGCC
GAGCTGCTGCGCCATCCCTTCTACCGGCGCGTCCGGCTGTCTCCCCTGTCGCTGGAGGGC
ACGACCGAGCTGACGGCGAAGACCCTGGGCACCCAGGAGGCCCAGGCCCACGGTGCCGTC
TACCACTCCCTCAGCGGGGGCAATCCGCTGCTGGTGCGGGCCCTGTTGAGGGACCACCGC
GACCGGTCGGCCGACGGTGACGCCGAGCCCGAAGTACCTTCCGCGGGAGAGGAGTTCGCA
CAGGCGGTGCTCGCCTGTCTGCGCGGCGGGGAGCCGCTCGTTCTCGGTGTGGCCCGCACG
ATGGCGGTGCTGGACTCCTGCTCCTCCCCCGACCGTATAGGCCGCCTGCTCCACCTCGGC
CCGTCCTCGGTGGCCGACGCGCTGAGACATGTGGAGGCCGCCGGCCTCGTCGCGGGCGGC
TGTTACCGTCACCCGGCGGCGCGGTCGGCCGTCCTGGACGACATCCCCCGGGGCGTGCTC
CGGAGACTGCGCCTCGACGTCGCGGAGTTACTCCACCACGAAGGGCTGCCGACGCCCACG
GTCGCGCGGCATCTGGTCGCCGTCCGCCACGTACCGGCGTGCTGGGCCGTCCCCGTCCTG
ATGGACGCCTCGGAGCACGCGCGCCGCAGCGGCGACGTCGGCTTCGCCCTGGAGTGCCTG
GAACTGGCGCTGTCCGGCTCCGACGACGTACGAGAGCGGGCGCTCGCCTCGATGATGCTC
GCGCGACTGGAGTGGCAGCTCAATCCCTCCACCGTGGGCCCCCGACTGGGGCCGCTCTCC
GAAGCGCTGCTGACGGGCGTCCTGCCCGCCGAACTGACCGTTCCGCTCTCCCGTGCCCTG
CTGTGGCACGGGCGCTCCGACGAGGCCGCCGAGTTGATCCGCACGCTGGGCCCGAAGGCC
CCGGGCCCCCACGGCCTGTTCCCGGAGAACCGGGAGTGGCTGCGGAATCGTTACCCCACA
ATGGTGTCCCTCCTGCCCACCGCCGAGGACGGCCCGGGTGGCCGCGACGGCAGGGAACCC
GCGACCGCCCGCCCCGTCCTGCTCGCGGAGACCGTCCTCGGCTCGACGCTGCGCAACGGC
GGTGACGAGTCCAGCGCCTGGAGTGCCGAACAGGTGCTGCGCTCCTGCGGCCTGGACGAG
GCCAATCTGTACGCGCTGGAGTCCGCGCTGCTCGCGCTCGTCTACGCGGACCGGCTCGGC
CAGGCCTCCATCTGGTCGGCCAAGCTCCTGCAGGAGGCCACCGTCCGGCAGGTGCCCACC
TGGCAGGCTAAGATCACCGCGATTCGCGCCGAACTGGCCCTGCGGCAGGGCGATCTGAAC
GAGGCGTGCGCCCTCGCCCGCCGGGCCATGACCCACCTCTCGCCCCGCAGTTGGGGAGTC
GCTGTCGGCGCGCCCCTGAGCACGCTCGTCCTGGCGGCGACCGCCATGGGGGCGGACGGC
GTCGCGGAGGAGTATCTGCGGCACTCGGTACCGGAGGCGATCTCCGAGTCCCGGTACGGC
CTGCAGTACCTCTACGCCCGGGGCCAGCACCACCTGGCCACCAACCAGGTGCACGCGGCA
CTGGACGACTTCCTGCGCTGCGGCGACCGGGCCCGCGCCTGGGACATGGACCTGCCCTCC
TTCCTGCCCTGGCGCAGCGGCGCGGCCGCCGCCCATCTGCGCCTCGGGCAGCGGGACCAG
GTCCGCCGGCTCGCGGAGGCGGAGCTGGCCCGCCCCGGCAGCGCCAAGTCCCGCAGCCGC
GGCGTCGCCATGTGCCTGCTCGCCGAGATCGCCGAACCGCGGCGCCGGACGAGTCTGCTG
CTGGAGGCCGTCAGTGTCCTGCGGCTCGCCGGGGACAGACTCGAACTGGCGCGGGCGCTG
GCCGCGTTGAGTTCCGCGCAGCGCGCGATCGGCGAGGCCGACCAGGCACGTCGGGCGCTG
TACCAGGCGCTGCACCTGGCCGATGTGTGCGGCGCCGAACATCTGCAACCCTCCCCGCAA
CTGCGCGGCAGGGAGGAGACACCGGCCGACCCGATCACCGCTCCACGGGATCCCCTCAGC
GCGGCGGAGCGACGCGTCGCGTCCCTGGCCGCCCTGGGCCACTCCAACCGCGAGATCGCC
GACCAACTGTGCGTCACCATCAGCACGGTGGAACAGCATCTGACCCGCGTGTACCGCAAG
CTCAACGTCACCAGGCGCGCGGATCTGCCCAGCGAGTTCCAGACCCTGACCGCCGGATCC
GTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [873-900]  PS00622
PS00622   HTH_LUXR_1
 [856-913]  2.49999811956465e-22 SM00421
SM00421   HTH_LUXR
 [859-873]  7.60000011115813e-08 PR00038 [873-889]  7.60000011115813e-08 PR00038 [889-901]  7.60000011115813e-08 PR00038
PR00038   HTHLUXR
 [857-909]  1.2e-12 PF00196
PF00196   GerE
 [852-917]  PS50043
PS50043   HTH_LUXR_2
IPR003593 AAA+ ATPase domain (Domain)
 [24-197]  1.6999992228405e-08 SM00382
SM00382   AAA
IPR011990 Tetratricopeptide-like helical (Domain)
 [662-866]  1.9e-11 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [867-909]  1.1e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [837-916]  3.0999994589937e-16 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-46]  0.086 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
first first   Conca_00020 Conca_00020