close all open/close all

CDS information : Conca_00020


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction4,514 / 3,408 / - [in whole cluster]
4,514 / 3,408 / - [in contig]
Locationcomplement(3408..4514) [in whole cluster]
complement(3408..4514) [in contig]
TypeCDS
Length1,107 bp (368 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF2
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MSAPPAALSPTERGTECDALIDDWLGTDLDAWTRKVVARHFHPETGSPYWLRRAAGLGFD
ARDITRYDQLTAFGPFPVDILRSQDPADLVPLDVPRPLTGRVWDTGGTTGAPCRLFYTPA
MLLHRGAWRRWSFVTEGFTQGRTWLQATPTGPHLIGNGMWEVSDLYAGQVYGVDMDPRWV
KRLIRAGRLADATEYTTHLLEQVTDVLIHGRIDYLNTTPALFLALVRRHPELVAPLRGVR
LSGTQLSPDMYRDFMAAMDDGICGRSYGNTFGNAAGLPVEQNAELMPYVPNYPQVTMNVV
RKEDWSTTVEYGTVGQVRLTVLHEDLFLPNILERDQALRYDTGSAWPSDGVANVTPLQTT
SSAPEGLY
selected fasta
>hypothetical protein [hypothetical protein]
GTGAGCGCGCCGCCGGCCGCCCTGTCGCCCACCGAGCGGGGCACGGAGTGCGACGCGCTG
ATCGACGACTGGCTCGGGACCGACCTCGACGCGTGGACACGGAAGGTGGTGGCGCGGCAC
TTCCACCCGGAGACCGGCAGTCCGTACTGGCTGCGGCGCGCCGCTGGACTGGGCTTCGAC
GCGCGGGACATCACCCGCTATGACCAGCTCACGGCGTTCGGACCGTTCCCGGTGGACATC
CTGCGCTCCCAGGACCCGGCGGATCTGGTGCCGCTCGACGTGCCGCGCCCGCTGACCGGC
CGCGTCTGGGACACCGGCGGCACGACCGGCGCGCCCTGTCGGCTGTTCTACACACCCGCC
ATGCTGCTGCACCGGGGCGCGTGGCGCCGCTGGTCCTTCGTCACCGAGGGGTTCACCCAG
GGGCGGACCTGGCTCCAGGCGACCCCCACGGGACCGCATCTGATCGGCAACGGCATGTGG
GAGGTGTCGGACCTGTACGCCGGTCAGGTGTACGGCGTCGACATGGACCCGCGCTGGGTC
AAGCGGCTCATCCGGGCCGGCCGGCTGGCGGACGCGACCGAGTACACCACCCATCTGCTG
GAGCAGGTCACCGACGTGCTCATCCACGGCCGGATCGACTACCTCAACACCACTCCCGCG
CTCTTCCTGGCGCTGGTGCGCCGCCATCCCGAACTGGTCGCACCGCTGCGGGGGGTGCGG
CTGAGCGGCACGCAGCTGAGCCCGGACATGTACCGGGACTTCATGGCCGCGATGGACGAC
GGAATCTGCGGCCGCAGCTACGGCAACACCTTCGGCAACGCGGCGGGGCTGCCCGTCGAG
CAGAACGCCGAACTCATGCCCTATGTTCCGAATTATCCACAGGTGACAATGAACGTCGTA
CGCAAAGAGGACTGGTCAACCACAGTGGAGTACGGCACTGTAGGACAGGTCCGACTGACC
GTGCTGCACGAAGACCTGTTCCTTCCCAACATCCTCGAACGCGACCAGGCGCTGCGTTAC
GACACCGGCTCCGCATGGCCGTCCGACGGAGTCGCGAATGTGACTCCGCTGCAGACCACT
TCGTCGGCTCCCGAGGGGCTCTACTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit