close all open/close all

CDS information : Conca_00030


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction5,473 / 4,511 / - [in whole cluster]
5,473 / 4,511 / - [in contig]
Locationcomplement(4511..5473) [in whole cluster]
complement(4511..5473) [in contig]
TypeCDS
Length963 bp (320 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative malonyl transferase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF1
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [putative malonyl transferase]
MALGFLFGGGVGTEVHGLEMYRAHPVMRELYEQVSEWTGLTVGQILEEELPEPQEERQSA
GTIRETALALGIHDVLAEQGLSPAVLGGVSLGAMTASCLAGSIGRRELFEMLAHARHTPE
LPADEPEQGLALAFAPAEGDLGAAYRGEGRAGVHLSGDFGPTADGAMRILMLSGEREALD
ALTADLPPGTVAPLPDRPIAVHSPLRGHFRAFMAPYIDAMPFKAPELPLVSCLERKTLTT
AEDVRDLFDRNPTDPISLVDVCDEMKDQGVRLGLIMGGSIPDGILRFPFPVVHVGRPEHI
QQVLTSVYEFGLDLSPVRAR
selected fasta
>hypothetical protein [putative malonyl transferase]
ATGGCATTGGGCTTTCTGTTCGGCGGCGGAGTGGGTACGGAAGTGCATGGTCTGGAGATG
TACCGGGCCCATCCCGTGATGCGGGAGCTGTACGAGCAGGTCTCGGAGTGGACGGGTCTC
ACGGTGGGCCAGATCCTGGAGGAGGAGCTGCCGGAGCCGCAGGAGGAGCGGCAGAGCGCG
GGGACGATCCGCGAGACGGCGCTCGCCCTCGGCATCCACGACGTGCTGGCGGAGCAGGGG
CTCAGCCCGGCGGTGCTGGGCGGAGTGAGCCTCGGCGCCATGACGGCGAGCTGTCTGGCC
GGCTCGATCGGGCGGCGGGAGCTGTTCGAGATGCTGGCGCACGCCCGTCACACCCCCGAA
CTGCCCGCCGACGAGCCGGAGCAGGGCCTCGCGCTGGCGTTCGCCCCGGCCGAGGGCGAC
CTGGGGGCGGCGTACCGGGGTGAGGGCCGGGCCGGGGTGCATCTGTCCGGGGACTTCGGG
CCGACGGCCGACGGGGCGATGCGGATCCTGATGCTGTCGGGCGAGCGTGAGGCACTGGAC
GCGCTGACGGCCGACCTTCCGCCGGGCACCGTCGCGCCCTTGCCGGACCGGCCGATCGCC
GTGCACTCGCCGCTGCGCGGCCACTTCCGCGCGTTCATGGCGCCGTACATCGACGCGATG
CCGTTCAAGGCGCCCGAACTGCCGCTGGTCTCCTGCCTGGAGCGCAAGACCCTGACCACG
GCGGAGGACGTACGGGATCTGTTCGACCGGAACCCCACGGATCCGATCAGCCTGGTGGAC
GTCTGCGACGAGATGAAGGACCAGGGCGTGCGCCTCGGCCTCATCATGGGCGGTTCCATC
CCGGACGGCATCCTCAGGTTCCCGTTCCCGGTGGTCCACGTCGGCAGGCCCGAACACATC
CAGCAGGTGCTGACCAGCGTGTACGAGTTCGGCCTGGACCTTTCACCGGTGCGGGCCCGG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [4-121]  5.40000000000002e-17 G3DSA:3.40.366.10 [199-277]  5.40000000000002e-17 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [2-277]  5.20000089003336e-16 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
SignalP
 [1-17]  0.703 Signal
Eukaryota   
TMHMM No significant hit