close all open/close all

CDS information : Conca_00050


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction14,295 / 28,772 / + [in whole cluster]
14,295 / 28,772 / + [in contig]
Location14295..28772 [in whole cluster]
14295..28772 [in contig]
TypeCDS
Length14,478 bp (4,825 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)modular polyketide synthase
GeneconB
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • CONB
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
[26976746] Alteration of Polyketide Stereochemistry from anti to syn by a Ketoreductase Domain Exchange in a Type I Modular Polyketide Synthase Subunit. (Biochemistry. , 2016)

close this sectionPKS/NRPS Module

2 methylmalonyl-CoA
3 malonyl-CoA
4 methylmalonyl-CoA
not conserved YASHS(S->A)
KS58..434
AT602..915
KR1222..1401
ACP1502..1572
KS1599..1974
AT2146..2478
KR2824..3004
ACP3116..3186
KS3215..3590
AT3756..4074
KR4402..4562
ACP4672..4742

close this sectionSequence

selected fasta
>polyketide synthase [modular polyketide synthase]
MTRTPSSSSPSSSASSQSPAASPSSSSDTTVVEALRDALKETARLRRENRQLQAGVGEPV
AVVGMACRLPGGVVSPAGLWELVAEGRDGVSGFPVDRGWDVEGLFDPDPDRPGTSYTRHG
GFLHDAAEFDAEFFGISPREALAMDPQQRLLLESSWEAVESAGIDPHALRGSRTGVFAGI
MYHDYGPALHIPAGGVDGQRLTGGAGSVLSGRVAFSLGLEGPAVTVDTACSSSLVAVHLA
VSALRAGECSLALAGGVTVMSSPGTFVEFSRQRGLSVDGRCRSFAASAGGTGWAEGVGLL
VLERLSDARRHGHRVLAVVRGSAVNQDGASNGLTAPSGRAQERVIRAALSSAGVTAAEVD
VVEAHGTGTRLGDPIEAQALLATYGRERPAERPLWLGSLKSNIGHAQAAAGVAGVIKMVM
ALQQRALPKTLHVDEPTPLVDWASGGVRLLTEQREWEAVEGRPRRAGVSSFGISGTNAHL
VLEEAPSAPEPEATPAPEPEATPEPEATPEPDTSPVPLVLSARTPDALRDQARRLLPLLR
DTAGPAARDLAFSLLTSRSLFDHRAVVGGDRRAWEEGLAALADGAPGADVAAGEASATGP
VVFVFPGQGSQWAGMARELLDESRVFAARMEECERALAPFVDWSLLDAVRSGQAWDRVDV
VQPALFAVMVSLAEVWRSFGVVPDAVVGHSQGEIAAAVVAGALSLEDGAKVVALRSRALG
VLAGRGGMVSVALAHDRLADLIADRPGLSIAAVNAPSAGVVSGDPDALAALLAHCEAQGV
RARRIDVDYASHSAHVEEIRETLLEALSGLRPTAAHVPLYSTVEGGWLDTARMDADYWYR
NLRATVGFAPAVRTLAESGYTGFIEVSPHPVLTMGIEETVHEAGCEAVVLGTLRRDEGGL
RRLHHALGEAFVRGLPVDWKPALAGTGARLVDLPTYPFQRRRYWLEAPRASDSAAPADDG
LWREIEAQDSAALADTLGVDPGAVGEVVPALSAWRSERIRGRRADSWRHRLGWRPLTLAP
RASLSGRWLVVLPATDSGADVLAALTAAGAEPVPVVVSAPDQDRESLATSLRAASGAEPV
AGVFSLLAEETHPHPAQPDVPAGLSLTLALVQALGDTGTDAPLWCATRALAAVGGGERPG
AGAQAAVAGLGRTVALERPDTWGGLVDLPAVLDERAADRLGAVLATVTDEDQVAVRSSGV
YGRRLLPVGPGRPAEARHSPSGTVLITGGTGGTGAQVARELAERGAAHLLLLSRRGPDAP
GADELRAELAALGARVTVAACDVADRAQLAAVVAAIPEEEPLTTVVHAAGVLDDGTLDAL
DPARLATLMRVKVTAARTLHEVTDGIGLADFVVFSSFMGVLGSAGQGNYAAANAALDALV
AERRAAGLPGTSVAWGAWAGGGMVDDRIAERLRRLGITPMEPRAAVRAMTTALADHDELC
LVADVDWQRFREAAGLRSTALLSSLPGAAGARTPAQTGPAEQDGQVRGQLAALPAAERSR
HITDLVRTHAATVLRHGAATDIAPGRAFAELGFDSLTAVELRNRLGTATGLRLPTTLLFD
HPTPQALAAHLLAELAPSGPGTEEADAALPGGTVAVDDDPIAIIGIGCRFPGSAHGPDAF
WQLLTEGRDVIADWPADRGWDADRLYDPDPDRPGTTYSRRGGFLHDAGGFDAAFFGISPR
EALAMDPQQRLLLETCWETVEHAGIDPTALRGRPVGVFVGTNGQDYPGVLHGAPGVSEGH
VMTGNTASVMSGRISYELGLDGPALTVDTACSSSLVTLHLAAQALRRGECAQALAGGVTL
MTTPKLFVEFSRQRGLAPDGRCKAFAAGADGTGWAEGVGMLLLERLSDARREGHRVLAVL
SGTAVNQDGASNGLTAPSGPAQQRVIRAALADARVTAAEIDAVEAHGTGTRLGDPIEAQA
LQAVYGAGRTADEPLWLGSVKSNIGHTQAAAGVAGVIKMALAIGHGELPRTLHADEPSTH
IDWDTAGLRLLGEPTPWPRTGRPRRAGVSSFGISGTNAHVIVEQAPDTGEADATDEAGGR
AGETATGGAGRTRPSPARTLPLLLSARTPAALRAQAARLLAHLDTSPGTPLPDVALALVR
GRAALEHRAAVPGDDETAARRALGALAAGTSDPDLVTGLAAPGRTVLLFPGQGSQRVAAG
AALYRDEPVFADALDDVLAHFAPHLDVPLRDILFAAEGDERAPLLDRTRYTQPALFALEV
ALFRLLDHWGVVPDLLIGHSVGELAAAHVAGVLDLPDACALVAARGRLMDELPGGGAMMA
VEAGEDEVLRALGELGLLQDTADGTVGIAAVNGPAATVISGDEDAVLRAVEEFRRQGRRT
RRLTVSHAFHSARMDGMLDAFREVAEGLTYAEPRIPVISNLTGEPAPASELCSPEYWVRH
VRGAVRFMDGVRRLVAEGATTFLEAGPGGVLSALVPACLPEDGPGAPGVTAIPLLPKGRP
EAASVVAALARLHVRAVAVDWTAGHEGTAAPHVDLPTYPFQHERFWPRPAARKGEDGAPT
GSDAFWDLVGTADAPSVASLLGLDERAPLGDVLPALSAWRARRDQEAAAARHHYRVAWQP
LTLPARIRLSGSWLLAVPDDPAVTETAEAVERALTEHGAETTVVRIGAGTGRAELAGQLP
AGATGVLSLLALTDLPHPDHAPLGAGLALTLTLLQALGDTGSRARLWCVTSGAVGAGQDT
PPSPAQARVWGLGRVAALEHPDRWGGLVDLPERLDPAALRGLCACLGGVAGVDAGHGDGT
TDGLAGEDQIAVRPSGLLGRRLVAAPESLPASGGRVIPGDAAATGDDVTPGGALAAPTGW
RPQGTVLVTGGTGGIGRHVARWLAREGAEHLVLAGRRGTAAPGAAALVAELEQAGARVTV
AACDLADRDATAALVGRLRAAGDTPRAVFHAAGTVSDTRTEQCAPAQLHAELAAKAAGAD
HLDALLADEPLDAFVLFSSIAGTWGSGGQAAYAAANAHLDALAARRRAQGRTALSVAWGP
WEGTGMADGDAGAGLRRHGLVGLRPETALTALRQALDTGRTEVVVADVDWRRFVPVFTSG
RPSRLLGALPETAGAAGAAEPSEGGPAADAALPEDHADGWRDRLTALPDAEGDRLLVELI
TTEAAAILGHESARRVDPERPLRDIGFDSITAVELRNRLVSATGFRLPVTGLFDHPTATG
LARHIREGLTGAAPPAAVPDTTAPPAPHATDPADDPLAVVAMACRFPAGVRAPEDLWRLV
ADEVDAIGAFPTDRGWDLDSLYDPDPDRPGTFYSSGGGFLDGAGDFDAGFFGISPREALA
MDPQQRLLLETSWEVLERAGIDPLSVRGSRGGVFVGVASQGYGTGPGTSSDGVEGHLLSG
NVTSVASGRIAYTLGIEGPAVTLDTACSSSLVALHLAGQALRAGDCSFALVGGAAVMAAP
DVFVEFSKQGGLSPDGHCRSFADGADGTGWGEGAGMILVERLSDARRLGHPVLALVRGSA
VNQDGASNGLTAPNGLAQQRVIREALAHARLTTADVDMVEAHGTGTVLGDPVEAQALLAT
YGQGRPVDRPLWLGSLKSNLGHTQAAAGVAGLMKTVLAMGHATLPRTLHADDPTSRVDWS
GGAVRLLDRARPWPAPGRPRRAGVSAFGMSGTNAHVVLEEAPPEPAVPEPPTAAQDTGDR
PDTHAAPALPWLLSARSQPALREQAARLHAHLTDRPELRPADVAHALATTRSALPHRAVV
VGTGRRELLDALAALADRSAASAAVEGQARGGGRTVFVFPGQGSQWAGMGSGLLDAAPVF
AERVAQCERALSPYVDWSLTGVLRGEPGAPSLERVDVVQPALWAVMVSLAALWRSCGVEP
SAVVGHSQGEIAAAVVAGALSLEDGAKVVALRSRALVALAGAGGMVSLAVSEDRARALLA
PHGDRVCVAAVNGPDAVVVAGRPDALTDLLAACERDGVRARRIPVDYAAHSDQVARVRDD
LLAALADVTPRTGGTPLYSTVTGEPLDGTLLTADYWYRNLREPVEFARATARLLDAGFDL
FVETSPHPVLTAGVEGTAERAGRTITTVGTLRRDDGEPARFLASLAEAWTTGATVAWPDV
EGPRPRPGARPVPLPTYAFQRTRFWLPTPGRTAPGADAAGGAEQDRFWAAVDSGDPAGLA
AALGADADATPEGFAPALREVLPVLSGWRRARLDRDAVRSLGYRVRWQPVADPPAAPLDG
DWLLVVPKQHTDDPLVGACQDALRLGGARARTVTVDAGDAARTAQDVADAVADATRPVSG
VLSLLALDERAAADGTPVLAGTAATLELLKALDTLGIDAPLWCVTGGAVAVHPDERLTRP
GGAQLWGLGRVVGLEQPGRWGGIADLPPSPGPDEARRLAAFLAGGHEEDHLAVRPTGAHA
RRLVHAPAPDASAGRDWTPAGGTALITGDTAVLGADIARWLARRGARQVVLAGDRSADQV
AVAALRDELTELGAELTVPDGRDPLAGLPGGAPLTVAVHLARAHDPGASLAELTPEDLEG
ALRSALGPVADLDALLDGHPAPDSVALAVLFPLSGVWGAARRGAATSAYAALEALTRDRR
DGGNRCVTLALGGLEPAPAGSDTAESPLDANTVLAALQQSLDHRDPAAILADVRWDRLVA
AVPDPRALRLLSELPEAASAPGDATRDDEDDAAAELARRLEPLDEPARRRLLLDLVCDHA
AAVLGHTGRQAVPADQAFSAVGFDSMLAVSFRNRLRTATGVPIAATVVFDHPTPTALADH
LYDGLCARPGPAVPALAELRALEAALTSADPRAEGADELGARLQDLVRTWARRTAPDTGP
ADTDAIGSASADELFDLLDNNFGMA
selected fasta
>polyketide synthase [modular polyketide synthase]
ATGACCCGAACGCCGTCGTCCTCGTCACCTTCTTCGTCAGCTTCCTCGCAGTCCCCTGCG
GCCTCCCCTTCGTCCTCCTCCGACACGACCGTCGTGGAGGCGCTCAGGGACGCCCTCAAG
GAAACCGCCCGGCTGCGCCGCGAGAACCGGCAACTCCAGGCGGGTGTGGGGGAGCCGGTG
GCGGTGGTGGGGATGGCGTGTCGGTTGCCGGGTGGGGTGGTGTCGCCTGCGGGGTTGTGG
GAGTTGGTGGCTGAGGGTCGGGACGGTGTGTCGGGGTTTCCGGTGGACCGGGGTTGGGAT
GTGGAGGGGTTGTTCGATCCGGATCCGGATCGGCCGGGGACGTCTTATACGCGTCATGGC
GGGTTCTTGCATGATGCGGCGGAGTTCGATGCGGAGTTCTTCGGGATCTCGCCGCGTGAG
GCGTTGGCGATGGATCCGCAGCAGCGGTTGTTGCTGGAGTCGTCGTGGGAGGCGGTCGAG
TCGGCCGGCATCGACCCGCACGCGCTGCGCGGCAGCCGCACCGGCGTCTTCGCCGGAATC
ATGTACCACGACTACGGACCCGCACTGCACATACCCGCCGGAGGCGTCGACGGCCAACGG
CTGACCGGTGGTGCCGGCAGCGTCCTGTCGGGTCGGGTGGCGTTTTCGTTGGGGCTTGAG
GGTCCTGCGGTGACGGTGGATACGGCGTGTTCGTCGTCGTTGGTGGCGGTGCATCTGGCG
GTGTCGGCGTTGCGGGCGGGGGAGTGTTCGCTGGCGTTGGCGGGTGGGGTGACGGTGATG
TCGTCGCCGGGGACGTTTGTGGAGTTTTCGCGGCAGCGGGGTCTGTCGGTGGATGGGCGG
TGTCGGTCGTTCGCGGCGTCTGCCGGTGGGACGGGGTGGGCCGAGGGGGTCGGTCTGCTG
GTGTTGGAGCGGTTGTCGGATGCGCGGCGCCATGGGCATCGGGTGTTGGCGGTGGTGCGG
GGGAGTGCTGTCAATCAGGACGGTGCGAGCAATGGGTTGACGGCGCCGAGTGGTCGGGCG
CAGGAGCGGGTGATCCGTGCGGCGTTGTCGTCGGCGGGTGTGACCGCTGCCGAGGTGGAT
GTGGTGGAGGCGCATGGCACGGGGACGCGGTTGGGTGATCCGATCGAGGCGCAGGCGTTG
CTTGCGACGTATGGGCGGGAGCGGCCAGCCGAACGGCCGCTCTGGCTGGGGTCGTTGAAG
TCGAACATCGGGCATGCGCAGGCGGCTGCCGGAGTGGCCGGTGTGATCAAGATGGTGATG
GCGCTTCAACAGCGCGCGCTGCCGAAGACGTTGCATGTGGATGAGCCGACGCCGTTGGTG
GACTGGGCTTCGGGTGGGGTTCGGTTGCTGACGGAGCAGCGGGAGTGGGAGGCGGTCGAG
GGGCGTCCGCGGCGGGCTGGGGTGTCGTCGTTCGGGATCAGTGGTACCAACGCCCATCTC
GTCCTGGAGGAAGCGCCCTCCGCCCCCGAACCGGAAGCCACCCCCGCCCCCGAACCGGAA
GCGACCCCGGAACCTGAAGCGACCCCCGAGCCCGACACCTCCCCGGTGCCGCTGGTGCTC
TCCGCCCGTACCCCGGACGCGCTGCGCGACCAGGCACGTCGCCTGCTGCCCCTGCTTCGG
GACACCGCCGGGCCCGCCGCCCGCGACCTCGCCTTCTCCTTGCTGACGTCCCGTTCGCTG
TTCGACCACCGTGCCGTGGTCGGCGGGGACCGGCGGGCATGGGAGGAAGGGCTCGCGGCG
CTCGCCGACGGTGCGCCCGGCGCGGACGTGGCGGCGGGCGAGGCCTCCGCCACCGGGCCG
GTCGTGTTCGTCTTCCCCGGTCAGGGTTCGCAGTGGGCCGGTATGGCACGGGAGTTGCTG
GACGAGTCGCGGGTGTTCGCGGCTCGGATGGAGGAGTGCGAGCGGGCTCTGGCGCCGTTC
GTGGACTGGTCGTTGCTGGACGCCGTGCGCTCGGGGCAGGCGTGGGACCGGGTCGATGTG
GTCCAACCCGCCCTCTTCGCGGTGATGGTGTCGCTGGCGGAGGTGTGGCGGTCGTTCGGT
GTGGTGCCGGACGCGGTCGTGGGCCACAGCCAGGGTGAGATCGCCGCCGCCGTCGTGGCG
GGCGCGCTCTCCCTGGAGGACGGGGCCAAGGTCGTGGCCCTGCGGAGCCGGGCGCTGGGT
GTGCTGGCCGGACGCGGCGGCATGGTCTCCGTGGCCCTCGCGCACGACCGCCTGGCCGAC
CTGATCGCCGACCGCCCCGGACTGTCGATCGCCGCCGTCAACGCCCCCTCCGCCGGGGTG
GTCTCCGGCGACCCCGACGCCCTGGCCGCTTTGCTCGCGCACTGCGAGGCGCAGGGCGTA
CGGGCCCGGCGCATCGACGTGGACTACGCCTCGCACTCCGCCCACGTGGAGGAGATACGA
GAGACGCTCTTGGAGGCCCTGAGCGGACTGAGGCCGACCGCCGCCCACGTGCCGCTGTAC
TCCACCGTGGAGGGCGGCTGGCTGGACACCGCTCGGATGGACGCCGACTACTGGTACCGC
AACCTGCGCGCCACCGTCGGCTTCGCACCGGCCGTCCGCACTCTCGCCGAGTCCGGGTAC
ACGGGGTTCATCGAGGTCAGCCCGCACCCCGTGCTCACCATGGGCATCGAGGAGACCGTC
CACGAGGCGGGCTGTGAGGCCGTCGTGCTCGGTACGCTCCGGCGCGACGAGGGCGGGCTG
CGGCGCCTGCACCACGCGCTCGGCGAAGCCTTCGTACGCGGGCTCCCCGTCGACTGGAAG
CCGGCCCTCGCCGGCACCGGTGCCCGCCTCGTGGACCTGCCCACCTACCCGTTCCAACGC
CGCCGCTACTGGCTGGAGGCCCCGCGGGCGTCGGACTCCGCCGCCCCGGCCGACGACGGA
CTGTGGCGGGAGATCGAGGCCCAGGACTCCGCGGCCCTCGCCGACACCCTGGGGGTCGAC
CCCGGGGCGGTCGGCGAGGTGGTGCCCGCCCTGTCCGCGTGGCGCTCCGAACGGATACGG
GGGCGGCGCGCCGACAGCTGGCGTCACCGTCTGGGGTGGCGCCCGCTGACGCTCGCGCCG
AGGGCGTCGCTGTCCGGGCGATGGCTCGTCGTGCTTCCGGCGACCGACAGCGGTGCCGAT
GTGCTGGCCGCGCTGACGGCGGCCGGGGCCGAACCGGTCCCCGTCGTCGTCTCCGCCCCC
GACCAGGACCGGGAATCCCTCGCGACCTCCCTGCGTGCCGCGTCGGGCGCGGAGCCCGTG
GCCGGCGTGTTCTCCTTGCTGGCCGAGGAGACGCACCCGCACCCCGCCCAGCCCGACGTG
CCCGCCGGGCTGTCCCTGACCCTCGCCCTCGTCCAGGCGCTCGGCGACACCGGGACGGAC
GCCCCGCTGTGGTGCGCCACCCGGGCCCTGGCGGCCGTGGGCGGCGGCGAGCGGCCGGGA
GCCGGTGCGCAGGCCGCGGTCGCCGGACTGGGCCGGACCGTCGCCCTGGAACGGCCCGAC
ACCTGGGGCGGCCTCGTCGACCTGCCCGCCGTGCTGGACGAGCGGGCCGCCGACCGGCTG
GGCGCGGTCCTCGCCACCGTCACCGACGAGGACCAGGTCGCCGTGCGCTCCTCCGGCGTG
TACGGCCGCCGTCTGCTCCCGGTCGGTCCCGGCCGCCCGGCCGAGGCCCGCCACAGCCCG
AGCGGCACCGTACTCATCACCGGTGGCACCGGCGGGACCGGGGCGCAGGTCGCCCGCGAA
CTCGCCGAGCGGGGAGCCGCCCACCTCCTGCTGCTCAGCCGCCGCGGACCCGACGCCCCC
GGCGCGGACGAACTGCGCGCCGAACTCGCCGCGCTCGGCGCGCGGGTGACCGTCGCCGCC
TGCGACGTCGCCGACCGCGCGCAGCTGGCGGCGGTCGTCGCCGCGATCCCCGAGGAGGAG
CCGCTCACCACGGTCGTGCACGCCGCCGGGGTCCTCGACGACGGCACCCTCGACGCCCTC
GACCCGGCCCGCCTCGCCACCCTGATGCGCGTCAAGGTCACCGCCGCCCGCACCCTGCAC
GAGGTCACCGACGGCATCGGCCTCGCCGACTTCGTCGTGTTCTCCTCCTTCATGGGCGTC
CTCGGCAGCGCCGGCCAGGGAAACTACGCCGCCGCCAACGCCGCGCTCGACGCCCTGGTC
GCCGAACGCCGGGCCGCCGGACTACCCGGCACGTCCGTCGCCTGGGGCGCCTGGGCCGGC
GGCGGCATGGTCGACGACCGGATCGCCGAACGCCTCCGCCGCCTCGGCATCACCCCCATG
GAACCCCGGGCGGCCGTCCGGGCCATGACCACCGCCCTCGCGGACCACGACGAACTCTGC
CTCGTCGCCGACGTGGACTGGCAGCGCTTCCGCGAGGCCGCCGGACTGCGCTCCACGGCA
CTGCTGAGCAGCCTGCCCGGGGCCGCCGGCGCGCGGACCCCGGCGCAGACCGGACCCGCC
GAGCAGGACGGGCAGGTGCGGGGGCAGCTCGCCGCGCTCCCCGCCGCCGAACGGTCCCGC
CACATCACCGACCTCGTCCGCACCCACGCGGCGACGGTGCTGCGCCACGGCGCGGCCACC
GACATCGCCCCGGGCCGGGCCTTCGCCGAACTCGGCTTCGACTCCCTCACCGCCGTGGAA
CTGCGCAACCGGCTCGGCACGGCCACCGGACTGCGGCTGCCCACCACCCTGCTCTTCGAC
CACCCCACACCGCAGGCACTCGCCGCCCATCTCCTCGCCGAACTCGCCCCGTCGGGCCCA
GGGACCGAGGAGGCCGACGCGGCCCTCCCCGGGGGGACGGTCGCCGTGGACGACGACCCG
ATCGCGATCATCGGCATCGGCTGCCGCTTCCCCGGCTCCGCCCACGGCCCGGACGCCTTC
TGGCAACTGCTCACCGAAGGACGGGACGTCATCGCCGACTGGCCCGCGGACCGGGGCTGG
GACGCCGACAGGCTCTACGACCCCGACCCGGACCGGCCCGGCACCACCTACAGCCGACGC
GGCGGATTCCTCCACGACGCCGGCGGCTTCGACGCCGCCTTCTTCGGGATCTCGCCCCGC
GAGGCCCTGGCCATGGACCCGCAGCAGCGGCTGCTCCTGGAGACCTGCTGGGAGACCGTC
GAACACGCCGGTATCGACCCCACCGCACTGCGCGGCCGCCCGGTCGGCGTGTTCGTCGGC
ACCAACGGCCAGGACTACCCCGGCGTCCTCCACGGCGCGCCCGGCGTCTCCGAGGGCCAC
GTCATGACGGGCAACACCGCCAGTGTGATGTCGGGCCGGATCTCGTACGAACTGGGCCTC
GACGGGCCCGCGCTGACCGTGGACACCGCGTGCTCCTCCTCGCTGGTGACCCTGCACCTG
GCGGCCCAGGCCCTGCGCCGGGGCGAGTGCGCGCAGGCCCTCGCCGGGGGTGTCACCCTC
ATGACCACGCCCAAGCTGTTCGTCGAGTTCAGCCGCCAGCGCGGACTGGCCCCGGACGGC
CGCTGCAAGGCGTTCGCCGCCGGCGCCGACGGCACGGGCTGGGCCGAGGGCGTCGGCATG
CTCCTCCTGGAACGCCTCTCGGACGCCCGCCGCGAAGGCCACCGGGTGCTCGCGGTGCTC
AGCGGCACCGCCGTCAACCAGGACGGCGCCAGCAACGGCCTGACCGCGCCCAGCGGGCCG
GCACAGCAACGCGTCATCCGGGCCGCGCTCGCCGACGCCCGGGTCACGGCCGCCGAGATC
GACGCAGTAGAGGCGCACGGCACCGGCACCCGGCTCGGCGACCCCATCGAGGCCCAGGCC
CTCCAGGCCGTGTACGGGGCCGGACGGACCGCCGACGAGCCGCTGTGGCTGGGGTCGGTC
AAGTCCAACATCGGCCACACCCAGGCCGCCGCCGGCGTCGCCGGCGTCATCAAGATGGCG
CTCGCCATCGGCCACGGCGAACTGCCCCGGACCCTGCACGCCGACGAGCCCAGCACCCAC
ATCGACTGGGACACGGCGGGCCTACGGCTCCTCGGCGAGCCCACCCCGTGGCCCCGGACC
GGACGCCCGCGCCGCGCCGGCGTCTCCTCGTTCGGCATCAGCGGAACCAACGCGCACGTG
ATCGTGGAACAGGCACCCGACACGGGCGAGGCGGACGCCACGGACGAGGCGGGCGGCAGG
GCCGGGGAGACCGCGACCGGCGGCGCGGGGCGGACGCGCCCGTCCCCGGCCCGGACGCTG
CCGCTGCTCCTGTCCGCCCGGACGCCCGCCGCGCTGCGCGCCCAGGCGGCCCGACTGCTC
GCCCACCTCGACACGAGCCCCGGCACGCCGCTGCCCGACGTGGCCCTGGCGCTCGTACGC
GGACGGGCCGCGCTGGAGCACCGGGCCGCCGTGCCCGGGGACGACGAGACGGCCGCGCGT
CGCGCGCTGGGGGCGCTGGCCGCCGGAACATCCGACCCGGATCTGGTCACCGGCCTGGCG
GCACCCGGGCGTACCGTGCTGCTCTTCCCCGGTCAGGGAAGCCAGCGGGTCGCCGCCGGA
GCCGCGCTGTACCGCGACGAGCCGGTGTTCGCCGACGCGCTGGACGACGTACTCGCCCAC
TTCGCCCCCCACCTCGACGTGCCGTTGCGCGACATCCTGTTCGCCGCCGAGGGCGACGAG
CGGGCCCCGCTGCTGGACCGCACCCGGTACACCCAGCCCGCGCTGTTCGCGCTGGAGGTG
GCGCTGTTCCGGCTGCTGGACCACTGGGGAGTCGTCCCGGACCTGCTCATCGGCCACTCG
GTCGGCGAACTCGCCGCCGCACACGTCGCCGGAGTGCTGGACCTGCCCGACGCCTGCGCC
CTGGTCGCCGCTCGTGGCCGTCTGATGGACGAACTGCCCGGCGGCGGCGCCATGATGGCG
GTCGAGGCCGGTGAGGACGAAGTGCTCCGGGCACTCGGCGAACTCGGCCTCCTCCAAGAC
ACCGCCGACGGCACGGTCGGCATCGCGGCCGTCAACGGACCGGCGGCCACCGTGATCAGC
GGTGACGAGGACGCCGTGCTGCGCGCGGTCGAGGAGTTCCGCCGCCAGGGCCGCCGGACC
CGGCGGCTCACCGTGAGCCACGCGTTCCACTCCGCCCGGATGGACGGCATGCTCGACGCC
TTCCGCGAGGTGGCCGAGGGCCTGACGTACGCCGAGCCCCGCATCCCCGTGATCTCCAAC
CTGACCGGTGAGCCCGCCCCCGCCTCCGAGTTGTGCTCCCCGGAGTACTGGGTGCGGCAC
GTGCGCGGCGCGGTGCGGTTCATGGACGGCGTACGGCGTCTGGTGGCCGAGGGCGCGACG
ACGTTCCTGGAGGCCGGGCCGGGCGGCGTGCTCTCCGCCCTGGTGCCCGCCTGTCTGCCG
GAGGACGGGCCCGGGGCGCCCGGCGTGACGGCGATCCCGTTGCTGCCCAAGGGCCGGCCG
GAGGCGGCCTCGGTCGTCGCGGCCCTCGCCCGCCTGCACGTCCGTGCGGTCGCCGTCGAC
TGGACCGCGGGGCACGAGGGCACCGCCGCCCCGCATGTCGACCTGCCCACCTACCCGTTC
CAGCACGAGCGGTTCTGGCCGCGCCCGGCCGCGCGGAAGGGCGAGGACGGCGCCCCCACG
GGCTCCGACGCCTTCTGGGACCTGGTCGGCACGGCCGACGCACCGTCGGTCGCCTCGCTG
CTGGGACTCGACGAGCGGGCGCCACTCGGTGACGTACTGCCCGCGCTGTCCGCCTGGCGC
GCGCGCCGGGACCAGGAGGCGGCCGCCGCCCGGCACCACTACCGCGTCGCCTGGCAGCCG
CTGACCCTGCCCGCCCGCATCCGGTTGTCCGGTTCGTGGCTCCTCGCGGTGCCGGACGAC
CCCGCGGTCACGGAGACGGCCGAGGCCGTCGAACGAGCCCTCACGGAGCACGGCGCCGAG
ACGACCGTCGTCCGGATCGGTGCCGGCACCGGGCGCGCGGAGCTGGCCGGACAACTCCCC
GCCGGGGCCACCGGTGTCCTCTCCCTGCTGGCCCTGACCGACCTTCCGCACCCGGACCAC
GCGCCGCTCGGGGCGGGGCTCGCCCTCACCCTGACCCTTCTTCAGGCCCTCGGCGACACC
GGCAGCCGCGCCCGGCTGTGGTGCGTCACGTCCGGCGCGGTCGGGGCGGGCCAGGACACG
CCGCCGTCGCCCGCCCAGGCCCGGGTGTGGGGACTCGGCAGGGTCGCCGCCCTGGAACAC
CCCGACCGCTGGGGCGGTCTGGTCGACCTGCCCGAGCGGCTCGACCCCGCAGCCCTGCGC
GGTCTGTGCGCATGCCTGGGGGGCGTGGCCGGCGTCGACGCCGGCCACGGCGACGGTACG
ACGGACGGGCTCGCCGGTGAGGACCAGATCGCGGTCCGCCCGTCCGGCCTGCTCGGCCGA
CGGCTGGTAGCCGCTCCGGAGAGCCTCCCGGCCTCCGGCGGCCGTGTCATCCCCGGCGAC
GCCGCCGCCACCGGCGACGATGTCACCCCCGGCGGCGCCCTAGCGGCCCCCACCGGCTGG
CGCCCCCAGGGAACCGTTCTGGTCACCGGCGGCACGGGCGGTATCGGCCGGCACGTCGCC
CGCTGGCTGGCCCGGGAAGGGGCCGAGCACCTCGTGCTGGCCGGCCGGCGGGGAACGGCC
GCCCCCGGCGCGGCGGCGCTCGTCGCAGAGCTGGAGCAGGCGGGGGCCCGGGTCACCGTG
GCCGCCTGCGACCTCGCCGACCGGGACGCGACGGCCGCGCTCGTCGGGCGGCTCCGGGCG
GCCGGGGACACACCGCGCGCGGTCTTCCACGCCGCGGGCACCGTCTCCGACACCCGCACC
GAGCAGTGCGCACCCGCACAACTCCACGCCGAACTGGCCGCCAAGGCGGCCGGAGCCGAC
CACCTCGACGCACTCCTCGCCGACGAACCGCTCGACGCCTTCGTGCTGTTCTCCTCCATC
GCGGGCACCTGGGGCAGCGGCGGCCAGGCCGCGTACGCCGCCGCCAACGCGCATCTGGAC
GCCCTCGCCGCCCGGCGCAGGGCCCAGGGGCGCACCGCGCTCTCCGTCGCGTGGGGCCCC
TGGGAGGGCACCGGCATGGCCGACGGCGACGCAGGCGCCGGACTGCGCCGGCACGGCCTC
GTCGGCCTGCGGCCCGAAACGGCGCTGACCGCACTCCGCCAGGCGCTGGACACGGGACGC
ACCGAGGTCGTCGTCGCCGATGTGGACTGGCGGCGGTTCGTCCCCGTCTTCACCTCCGGG
CGCCCCAGCAGGCTCCTGGGAGCACTGCCCGAGACCGCCGGGGCGGCCGGGGCCGCCGAA
CCCTCCGAGGGCGGGCCCGCGGCCGACGCCGCCCTGCCCGAGGACCACGCCGACGGGTGG
CGCGACCGGCTCACGGCTCTCCCCGACGCGGAGGGCGACCGGCTCCTCGTCGAACTGATC
ACCACCGAGGCGGCGGCGATCCTCGGCCATGAGTCGGCCAGGCGGGTCGACCCCGAACGC
CCGCTGCGCGACATCGGCTTCGACTCCATCACGGCCGTCGAACTGCGCAACCGGCTCGTC
TCCGCCACCGGCTTCCGCCTGCCGGTCACCGGGCTCTTCGACCACCCCACGGCGACCGGC
CTCGCCCGGCACATCCGTGAGGGCCTCACGGGCGCCGCACCGCCCGCCGCCGTCCCGGAC
ACCACCGCACCCCCGGCCCCGCACGCCACCGATCCCGCCGACGACCCGCTCGCCGTGGTC
GCGATGGCCTGCCGCTTCCCCGCGGGCGTGCGCGCCCCGGAGGACCTGTGGCGGCTGGTG
GCCGACGAGGTGGACGCCATCGGCGCCTTCCCCACCGACCGGGGCTGGGACCTGGACTCC
CTGTACGACCCCGACCCGGACCGGCCGGGCACCTTCTACAGCTCCGGCGGCGGATTCCTC
GACGGGGCGGGCGACTTCGACGCCGGCTTCTTCGGGATCTCGCCCCGCGAGGCCCTGGCC
ATGGACCCGCAGCAGCGGCTCCTCCTGGAGACCTCCTGGGAGGTCCTCGAACGCGCCGGG
ATCGACCCGCTGTCGGTCCGCGGCAGCCGGGGCGGCGTCTTCGTCGGCGTGGCCTCCCAG
GGCTACGGCACCGGGCCGGGCACATCCTCCGACGGCGTCGAAGGGCATCTGCTGAGCGGC
AACGTCACCAGCGTGGCGTCCGGCCGGATCGCCTACACGCTCGGTATCGAGGGCCCGGCC
GTCACCCTCGACACGGCCTGCTCCTCCTCACTGGTCGCCCTGCACCTCGCCGGTCAGGCG
CTGCGGGCCGGTGACTGCTCCTTCGCGCTCGTCGGCGGCGCCGCCGTGATGGCCGCACCG
GACGTGTTCGTGGAGTTCAGCAAGCAGGGCGGTCTCTCGCCCGACGGCCACTGCCGCTCC
TTCGCCGACGGCGCCGACGGCACCGGCTGGGGCGAGGGCGCCGGCATGATCCTCGTCGAG
CGGCTGTCCGACGCCCGGCGCCTCGGTCACCCCGTGCTCGCCCTGGTCCGTGGTTCGGCG
GTCAACCAGGACGGCGCCAGCAACGGCCTCACCGCCCCCAACGGCCTCGCCCAGCAGCGA
GTGATCCGCGAGGCGCTCGCCCACGCCCGCCTGACCACCGCCGACGTCGACATGGTCGAG
GCGCACGGCACCGGCACCGTCCTCGGCGACCCCGTCGAGGCACAGGCACTGCTGGCCACC
TACGGCCAGGGCCGCCCGGTGGACCGGCCGCTCTGGCTGGGCTCGTTGAAGTCCAACCTA
GGCCACACCCAGGCCGCGGCGGGCGTCGCGGGACTGATGAAGACCGTTCTGGCCATGGGG
CACGCGACGCTGCCCAGGACCCTGCACGCCGACGACCCCACCTCCCGGGTCGACTGGTCC
GGCGGCGCCGTCCGGCTCCTCGACCGGGCCCGCCCCTGGCCGGCCCCCGGCCGTCCCCGG
CGCGCCGGAGTCTCGGCGTTCGGCATGAGCGGCACCAACGCCCATGTGGTCCTGGAGGAG
GCGCCCCCGGAGCCGGCCGTCCCGGAGCCGCCGACCGCCGCCCAGGACACCGGCGACCGG
CCCGACACCCACGCGGCGCCCGCGCTGCCCTGGCTCCTCTCCGCCCGCTCGCAGCCGGCC
CTGCGCGAACAGGCCGCGCGGCTGCACGCCCACCTCACCGACCGACCCGAACTGCGGCCG
GCCGACGTCGCCCACGCGTTGGCGACCACCAGGTCCGCCCTCCCGCACCGGGCCGTCGTC
GTCGGCACCGGCCGCCGTGAACTGCTGGACGCGCTGGCCGCCCTCGCGGACCGGTCGGCC
GCGTCCGCAGCCGTCGAGGGACAGGCCCGCGGCGGCGGCCGTACCGTCTTCGTCTTTCCC
GGCCAGGGTTCCCAGTGGGCGGGGATGGGGTCGGGTCTGCTGGATGCTGCTCCGGTCTTC
GCGGAGCGGGTGGCGCAGTGCGAGCGGGCGCTGTCGCCGTACGTGGACTGGTCGTTGACC
GGTGTGCTGCGCGGCGAGCCGGGTGCGCCGTCGTTGGAGCGGGTGGACGTGGTGCAGCCC
GCGTTGTGGGCCGTGATGGTGTCGTTGGCGGCGCTGTGGCGGTCCTGCGGTGTGGAGCCT
TCGGCGGTGGTCGGGCACAGTCAGGGGGAGATCGCGGCCGCCGTGGTGGCGGGGGCGCTG
TCCCTGGAGGACGGGGCCAAGGTCGTCGCCCTGCGCAGCCGGGCCCTCGTGGCGCTGGCC
GGGGCCGGCGGCATGGTGTCCCTCGCCGTCTCCGAGGACCGGGCCCGCGCCCTCCTGGCA
CCCCACGGCGACCGTGTCTGCGTGGCCGCGGTGAACGGCCCCGACGCGGTGGTGGTGGCC
GGCCGGCCGGACGCGCTCACGGACCTCCTCGCGGCCTGCGAGAGGGACGGCGTACGGGCC
CGGCGCATCCCCGTCGACTACGCGGCCCACTCGGACCAGGTGGCCCGGGTCCGCGACGAC
CTGCTCGCCGCGCTGGCCGACGTGACGCCCCGCACGGGCGGGACACCGCTGTACTCCACG
GTCACCGGCGAACCCCTCGACGGAACGCTGCTGACGGCGGACTACTGGTACCGGAACCTG
CGTGAACCCGTCGAGTTCGCGCGTGCCACCGCACGGCTGCTGGACGCCGGATTCGACCTC
TTCGTCGAGACGAGCCCGCACCCCGTGCTCACCGCCGGCGTCGAGGGAACCGCCGAACGG
GCGGGCCGGACCATCACTACCGTCGGGACGCTGCGTCGCGACGACGGCGAACCCGCACGG
TTCCTCGCCTCGCTCGCCGAGGCATGGACCACCGGAGCCACGGTGGCCTGGCCGGACGTC
GAGGGCCCGAGGCCGCGGCCCGGCGCCCGACCCGTCCCCCTGCCCACATACGCCTTCCAG
CGGACCCGGTTCTGGCTGCCCACCCCGGGCCGTACCGCCCCGGGGGCCGACGCGGCCGGC
GGCGCCGAACAAGACCGCTTCTGGGCGGCGGTGGACAGCGGCGACCCGGCCGGGCTGGCC
GCCGCCCTCGGCGCGGACGCCGACGCCACACCGGAGGGCTTCGCCCCGGCGCTGCGCGAG
GTGCTGCCGGTGCTGTCCGGCTGGCGTCGCGCCCGGCTCGACCGGGACGCCGTACGGTCC
CTCGGCTACCGGGTCCGCTGGCAGCCGGTGGCCGACCCGCCCGCCGCGCCGCTCGACGGC
GACTGGCTCCTCGTCGTACCGAAGCAGCACACCGACGACCCGCTCGTCGGCGCGTGCCAG
GACGCGCTGCGGCTCGGCGGCGCGCGGGCCCGTACCGTCACCGTCGACGCGGGCGACGCG
GCCCGGACCGCGCAGGACGTCGCCGACGCCGTCGCGGACGCGACCCGGCCGGTCTCCGGC
GTGCTCTCCCTGCTGGCCCTGGACGAGCGTGCGGCGGCGGACGGGACTCCGGTGCTCGCC
GGAACCGCCGCCACCCTCGAACTGCTCAAGGCCCTGGACACCCTGGGGATCGACGCCCCG
CTGTGGTGCGTGACCGGCGGCGCGGTCGCCGTCCACCCCGACGAGCGGCTCACCCGTCCG
GGCGGGGCCCAGCTGTGGGGGCTCGGCCGGGTCGTCGGCCTGGAACAGCCGGGCCGCTGG
GGCGGCATCGCCGACCTGCCGCCGAGCCCCGGCCCCGACGAGGCGCGCCGCCTCGCCGCC
TTCCTCGCGGGCGGCCACGAGGAGGACCACCTCGCCGTACGGCCCACCGGCGCTCACGCG
CGCCGGCTCGTCCACGCCCCGGCCCCCGACGCCTCGGCGGGCCGCGACTGGACGCCGGCC
GGAGGCACCGCCCTGATCACCGGCGACACCGCCGTGCTGGGCGCGGACATCGCCCGCTGG
CTGGCCCGGCGCGGCGCCCGCCAGGTCGTCCTGGCCGGGGACCGGAGCGCGGATCAGGTG
GCCGTGGCCGCCCTGCGTGACGAACTCACCGAACTGGGAGCCGAGTTGACGGTTCCCGAT
GGCAGGGACCCCTTGGCCGGCCTGCCCGGCGGGGCGCCCCTGACCGTCGCCGTCCACCTC
GCCCGCGCCCACGACCCCGGCGCCTCGCTCGCCGAACTCACCCCCGAGGACCTGGAGGGC
GCCCTGCGTTCCGCCCTCGGCCCGGTGGCCGACCTCGACGCGCTGCTCGACGGCCACCCG
GCACCGGACTCCGTCGCCCTCGCCGTGCTGTTCCCGCTGAGCGGTGTCTGGGGGGCCGCC
CGGCGGGGCGCCGCCACCAGCGCGTACGCCGCCCTCGAAGCGCTGACCCGCGACCGCCGC
GACGGGGGGAACCGCTGCGTCACCCTCGCCCTCGGCGGCCTGGAACCCGCGCCCGCCGGA
TCCGACACGGCGGAGAGCCCGCTGGACGCGAACACCGTCCTCGCGGCCCTGCAACAGTCG
CTGGACCACCGAGACCCGGCCGCGATCCTCGCCGACGTCCGCTGGGACCGCCTCGTGGCC
GCCGTGCCCGACCCCCGAGCGCTGCGGCTGCTCAGCGAACTGCCCGAGGCCGCCTCCGCC
CCGGGGGACGCCACGCGGGACGACGAGGACGACGCGGCCGCCGAACTCGCCCGCCGGCTC
GAACCGTTGGACGAACCCGCGCGACGCCGGCTGCTGCTCGACCTGGTGTGCGACCACGCG
GCCGCGGTCCTCGGCCACACCGGCCGCCAGGCCGTCCCGGCCGACCAGGCGTTCTCCGCC
GTCGGGTTCGACTCGATGCTCGCCGTGTCCTTCCGCAACCGGCTGCGCACGGCCACCGGC
GTCCCCATCGCCGCGACGGTGGTGTTCGACCATCCCACCCCCACCGCCCTCGCCGACCAC
CTGTACGACGGGTTGTGCGCCCGTCCCGGACCGGCCGTTCCCGCGCTCGCCGAACTCCGG
GCGCTGGAGGCGGCCCTGACCTCCGCAGACCCCCGCGCCGAGGGCGCCGACGAGCTCGGC
GCGCGCCTTCAGGACCTCGTACGGACCTGGGCCCGGCGCACGGCGCCCGACACCGGCCCG
GCGGACACCGACGCGATCGGTTCGGCCAGCGCCGACGAACTGTTCGACCTGCTGGACAAC
AACTTCGGAATGGCCTGA
[2] KS58..434
[2] AT602..915
[2] methylmalonyl-CoA789..793
[2] KR1222..1401
[2] ACP1502..1572
[3] KS1599..1974
[3] AT2146..2478
[3] malonyl-CoA2347..2351
[3] KR2824..3004
[3] ACP3116..3186
[4] KS3215..3590
[4] AT3756..4074
[4] methylmalonyl-CoA not conserved YASHS(S->A)3947..3951
[4] KR4402..4562
[4] ACP4672..4742
[2] KS172..1302
[2] AT1804..2745
[2] methylmalonyl-CoA2365..2379
[2] KR3664..4203
[2] ACP4504..4716
[3] KS4795..5922
[3] AT6436..7434
[3] malonyl-CoA7039..7053
[3] KR8470..9012
[3] ACP9346..9558
[4] KS9643..10770
[4] AT11266..12222
[4] methylmalonyl-CoA not conserved YASHS(S->A)11839..11853
[4] KR13204..13686
[4] ACP14014..14226

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [595-722]  G3DSA:3.40.366.10 [789-905]  G3DSA:3.40.366.10 [2140-2272]  G3DSA:3.40.366.10 [2347-2466]  G3DSA:3.40.366.10 [3746-3879]  G3DSA:3.40.366.10 [3947-4063]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [4402-4562]  6.40000000000001e-18 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1530-1545]  PS00012 [3144-3159]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1502-1572]  PS50075 [3116-3186]  PS50075 [4672-4742]  PS50075
PS50075   ACP_DOMAIN
 [1505-1571]  1.4e-12 PF00550 [3120-3185]  2.4e-10 PF00550 [4675-4741]  9.7e-10 PF00550
PF00550   PP-binding
 [1501-1576]  2.29999999999998e-61 G3DSA:1.10.1200.10 [3116-3189]  2.29999999999998e-61 G3DSA:1.10.1200.10 [4670-4743]  2.29999999999998e-61 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1495-1615]  1e-26 SSF47336 [3109-3231]  2.39999798157265e-23 SSF47336 [4664-4759]  8.20001307135067e-22 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1222-1400]  2.29999999999998e-59 PF08659 [2824-3003]  8.70000000000003e-63 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [58-308]  1.10000000000001e-93 PF00109 [1599-1849]  2.90000000000003e-97 PF00109 [3215-3465]  1.10000000000001e-88 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [316-434]  1.99999999999999e-46 PF02801 [1857-1974]  7.69999999999997e-46 PF02801 [3473-3590]  1.5e-44 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [602-915]  6.20000000000009e-109 PF00698 [2146-2478]  3.7e-62 PF00698 [3756-4074]  2.70000000000002e-107 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [600-888]  6.59996953923913e-68 SSF52151 [2144-2441]  6.00001679190159e-69 SSF52151 [3754-4066]  1.3000049540733e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [724-788]  3.60000433965927e-17 SSF55048 [2274-2346]  7.49999605851445e-18 SSF55048 [3881-3946]  2.800005042611e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [58-319]  G3DSA:3.40.47.10 [320-487]  G3DSA:3.40.47.10 [1601-1861]  G3DSA:3.40.47.10 [1862-2027]  G3DSA:3.40.47.10 [3218-3477]  G3DSA:3.40.47.10 [3478-3644]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [50-487]  2.99998750445706e-100 SSF53901 [1598-1973]  6.10002656149838e-101 SSF53901 [3207-3589]  1.39999277195148e-97 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1222-1407]  7.09999999999991e-86 G3DSA:3.40.50.720 [2824-3006]  1.29999999999998e-75 G3DSA:3.40.50.720 [4400-4504]  1.40000000000001e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [221-237]  PS00606 [1762-1778]  PS00606 [3378-3394]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [604-897]  3.699978135861e-119 SM00827 [2148-2459]  6.59996953923913e-123 SM00827 [3758-4055]  1.69998802370953e-121 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1503-1575]  8.69997440322062e-35 SM00823 [3117-3189]  2.30000440726534e-29 SM00823 [4673-4745]  7.99999145876753e-30 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [60-487]  SM00825 [1601-2027]  SM00825 [3217-3643]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1222-1401]  1.79999754022375e-54 SM00822 [2824-3004]  2.60000517657733e-56 SM00822
SM00822   PKS_KR
SignalP
 [1-21]  0.988 Signal
Bacteria, Gram-negative   
 [1-26]  0.974 Signal
Bacteria, Gram-positive   
TMHMM No significant hit