close all open/close all

CDS information : Conca_00060


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction28,787 / 43,699 / + [in whole cluster]
28,787 / 43,699 / + [in contig]
Location28787..43699 [in whole cluster]
28787..43699 [in contig]
TypeCDS
Length14,913 bp (4,970 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)modular polyketide synthase
GeneconC
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • CONC
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)

close this sectionPKS/NRPS Module

5 methylmalonyl-CoA
6 methoxymalonyl-ACP
7 malonyl-CoA
KS34..405
AT561..876
KR1195..1375
ACP1483..1553
KS1579..1953
AT2109..2428
KR2752..2931
ACP3033..3103
KS3131..3507
AT3667..3999
DH4048..4211
KR4529..4709
ACP4816..4886

close this sectionSequence

selected fasta
>polyketide synthase [modular polyketide synthase]
MPDEQKLLEYLRRATADLGQARQRLREEEDARHEPIAIVSMSCRYPGGADDPEQLWDMVS
SGTDAISEWPADRGWDTAALYDPDPDRPGTSYTRHGGFLHRAGEFDAAFFGMSPREALAT
DPQQRLLLETSWETLERAGIDPAVLKGTATGVFVGAMTNGYGDGSRDQSDVQGLLHTGTA
GSVISYTLGLEGPAVTVDTACSSSLVALHLAIRALRSGECSLALACGVTVMPHPDPFVAF
SRQRALAPDGRCKAFAAGADGTSWSEGVGVLLLERLSDARRHGRRVLAVVRGSAVNQDGA
SNGLTAPNGPSQQRVIRAALADARLLPGDVDAVEAHGTGTRLGDPIEAQALLATYGQDRP
ADRPLLLGSLKSNIGHTSAAAGVGGVIKMVQALRHEVLPRTLHVDAPSPQVDWSAGAVEL
LTEERPWAFDPDRPRRAAVSGFGVSGTNAHVILEEAPESAETPEAPETATPLPLVPWVLS
ARGEDALTDRARQLLALADADALIPGAVARALATGRSPLEHRAVVVAGDAEGFRTGLTAL
ATGGEAANLVRGLAGPAGRTVFVFPGQGTQWTGMALELLDTSPVFAARMADCERALAPHV
DWSLTDVLSSATDLERVDVVQPVLWAVMVSLAALWRSAGVEPDAVLGHSQGEIAAAVVAG
ALSLEDGAKVVALRSQAITAIAGRGGMASVPLPPEELAGHLGPWGDRLSVAAANGPAATV
LSGDTEAIDGIVAQLQAEDVRARRIPVDYASHSAHVEEIRERLLECLADIEPTTGQVPFF
STVDLNWQDSGALDAEYWYRNLRQTVRFEEATRTLLAQGFRFFVESSAHPVLTVGISQTA
EAEESDAVAVGTLRRDQGGLDRFLLSLAEAHTGGLAPEWDTLLAGHPGDTVDLPTYPFQR
RRYWLERPSAHAEDTAATDPADAAFWESVGGQDLPALTTTLGVRPEDPLTVVLPALADWR
RRRDERATVDSWRYRVDWRPLADAPAGRTAAAPNGTWLVAVTDGTEGDPAREAAVRALRE
AGAVPVPVVLTEAHTDRATLTAHLSEASTGPVHGVLSLVALDERPHPSHPHLPLGLALTL
TLVQALGDAGVTAPLWCATRGAVTTGRDDAVTSPGQHMVWGLGRCAALEHPQRWGGLVDL
PDTLDERAAARLCGILAGRDDEDQVAVRPSGAYGRRLVRARPADPARADAWQPRGTVLVT
GGTGGVGAHLARWLAKGGAEHLVLVGRRGADTPGAADLTAELTALGTRVTVAACDVADRD
RLAELVAGLEQDGPPIRTVIHAAGTGLLVPLSDTDPDEFADTLYAKVAGAENLDAVFDRD
DLDTFVLFSSISGVWGSGDHGAYAAANAHLDALADRRRARGRTATSVVWGIWDPEGGAGM
AANLVEEQLRGRGIPFMAPQVALTGLQQVLTDDETVVLVTAVDWDRFAPVFTSARPSPLI
GDLPEVRRALAEETAPAQDGDDTASSLRDRIADLPPADRDRLLTDLVRGHAAAVLGHGSA
DAIAPERAFRELGFDSLTAVEMRNRLNAATGLRLPLTVLFDYASADALARHLREELLGPD
TAAPTGPAVPAHVPADADDPIAIVGMSCRYPGDVRTPEDLWRLVAEGRDVISALPADRGW
DLDGLYDTDPDRPGTTYSSEGGFLYDAGQFDPAFFGISPREALAMDPQQRLLLETSWEAL
ERAGIDPASLRGGQVGVFAGAAYQGYGGLSDVPEEVEGHLIAGISTSILSGRIAYTLGLE
GPAVTVDTACSSSLVAVHLAAQALRSGECSLALAGGVTVMGTPLSFTGFSRQRGLAADGR
CKSFGADADGFGMAEGVGLLLLERLSDARRNGHRVLALVRGSAVNQDGASNGLTAPSGLA
QQRVIRSALAGAGVPPAEVDVVEAHGTGTRLGDPIEAQALLATYGQDRPADRPLLLGSLK
SNIGHSQAAAGVAGIIKMVQAMRHELLPRTLHAEVPTPNVDWSVGAVELLTESRPWTRGG
HPRRAGVSSFGLSGTNAHVIIEEPYDEEPGEAPEGNAPGTAVPWLLSGRTPEALREQAAR
LHTHLTDRPELRPHDVGLTLATARSAFEHRAVVVGADRATLLTGLAALAAGENDPAVVRG
TAATPGRTVFVFPGQGSQWVGMAVGLLDSAPVFAERIAECERALSPYLDWSLTDVLRAAP
DSPPLDRVDVVQPVLFSMMVSLAALWRSYGVEPSAVVGHSQGEIAAAVVAGALTLEDGAR
IVARRSQILTALVGRGTMLFVALPDEEVRERLAPWAGKLSVAAVNGPAAVTVSGDPEALE
EFGERLSEDGVMRWTIPGVTFAGHSPQVDEVRGELLDALAGVAPRRTDIAFYSTVTGGVV
DTTTLDTEYWYRNLREPVEFHRTVAALIEDGHDTFVETGPHPVLTVWIERSLEAADVTGR
VTGTLLTDDGGPDRFLTALAAPHVHGVPVDWSAVFAGADARPVELPTYAFQRQRYWLEPT
ATAAGTAAGAPGADRPGDTAFWDAVERGDLTAVATALNLPDEDDSVRTSLGGVLPALADW
QRGRRSRTAIDGWRYRVTYKTLHPAPGTPALTGTWWVVVPADAATHPMVTGALRALERHG
ALAVPVEIGAADNDRAALAARLGAAAAPDGGVLSLLALAEQPYTDGTALPTGLALTTTLL
QALGDAGINAPLWSVTCGAVSVGRSDALTAPAQATLWGLGAVAGVEYPERWAGLVDLPAD
LDDRSGGRLAAVLAGLDGEDQVAIRPSGIYGRRLVRALPGDETAPVAWKPDGTVLITGGT
GALGAHVARRLARSGTRHLLLTGRRGPDTPGAAELVAELADLGAEARVAACDAADRDALA
ALLAGIPDDRPLRAVVHAAGVLDDGVLDTLTPERAAGVLRPKMDAARNLDALTRDLDLSA
FVLFSSLAGTLGGTGQGSYAAANAYLDALAEHRRSLGLPATAVAWGLWAGDSAANSAREQ
LVRNGIPPMDPELAVTALEQAVEQGENRLILCDFAWDRFAPAYTALRPSAVLRELPEARD
ILAAAGADGQDTGADSLAGRLAALSVQERQEELVRLIRTEVAAVLGYPDPADVDPDRVFK
DLGFDSLTAVDLRNRLSEVTGLRLSVTLVFDHPTVTALVDHVRSELGGTAPVSTSAPVVP
DSPAMPVVDDDAIAVVSMSCRYPGGVTTPEELWRLVSSGADAITEFPTGRGWDLDELYDP
DPEKIGRTYAREGGFLHDADHFDPAFFGISPREALSIDPQQRLLLEISWEAFERAGIDPA
SLKGSRAGVFVGSSYRDYGSRVQEPTEETEGYLGIGSAGSVASGRISYTFGLEGPAVTVD
TACSSSLVAVHLAAQALRSGECTLALAGGVTVMSTPGAFIEFSRQRGLAADGRCKPFAEA
ADGTAWAEGAGLVVLERLSDARRNGHPVLALVRGSAVNQDGASNGLTAPNGPSQQRVIRQ
ALASAGLNSADVDAVEAHGTGTRLGDPIEAQALLATYGQDRPADRPLLLGSLKSNMGHAQ
AAAGIAGLQKMVLAMRHGVLPRTLHVDAPTPFVDWSAGAVSLLTEDTPWPDNGHPRRAGI
SSFGVSGTNAHTILEHVPDEYAPDGLDEAGDDAADDGTVLPWLLSARSRAALRAQAQRLL
EHTDARPGLRPADIAHTLATGRSAFEYRGAVVGDSREALTGGLKALATGGSAPGVTQGTA
VAGKVAFLFAGQGSQRAAMGAELYARYPVFADAFDEICAELDPLLDRPLREVVFAPAGSD
AAALLDRTEYTQPALFAVEVALFRLVEHWGVVPDLLLGHSIGVLAAAHVAGVFTAPDAAA
LVAARGRLMQALPEGGAMVALTASEADATALLAPYDGRVAVAAVNGPASVVVSGDEDAVL
DLAEQWRDRGGKARRLTVSHAFHSPHMDAMLDEFRRVAESLDYRAPRIPLVSDVTGELAT
PEQLGSPEYWVRHVREAVRFHDGMRRLAAEGAVTYLELGPDGSLTAMGRDCFAEADPIGS
DDPVDPSAAGPLVPLLRKDRTETRALTDALAQLYVRGTAVDWPTVLEATGRGGQVELPTY
AFQRERYWLEATAASGGMAAAGLLPADHPLLGAAVPLADTDGVLFTSRLSVRTHPWLADH
GVFGTALFPATALLELAVRAGDQVGCGQVEELTLETPLVIPAQGSVALQLTVGAPDSTGA
RPLSVHTRPGDTDDMGWTCHARGLLVPAADETEPADSVTWPPTGAQPVRIDGLYERFAEG
GFGYGPAFQGLREVWRLGDDVYAEASLPPEQQAEAAKFGLHPALLDSALHALIFGVLEGT
DQGWLPFSWNGIRLHASGARALRIRLTPAGNNAVSVQATDTAGQPVVSIRSLVLRPVNPD
QVRAARTAHHDDLYRVEWPTLSRPAAADSDGWAVIGPEAPDWAAHGITRSATGLEALSRE
IAGEAGGVAPPTVVLAHVPAAPAGLGQPDAVRHVTGHTLTLVQEWLADDTFADAKLVLVT
RGGVPVSADGVAQDLAHAAVWGLVRSAQTENPGRFVLADLDDASEDALVAAVASGEPQLA
LREGRTHIARLTKVPVTEQPGTPDWGRPGTVLITGGTGAIGSVLARHLAAEHGVKRLLLT
SRRGPAAEGAADLVVELAALGAHAEIVACDAADRDALARLLGALPEDQSLTAVVHAAGTI
ADGVVDAMTPVRLDTVLRPKVDAAWNLHELTEGMDLSAFVVFSSIAGVFGGMGQGNYAAA
NSFLDALAHHRRQRGLPAASLAWGLWANKGGMSGGLDEADFRRIARGGIIAFSPAEGAAL
FDTANASSEPVVLPLRLDTTALAAQSGADGVPALLRGLVRPAARRSAAAGEAAPDAADTL
RRTLAGQPEHRRLRTLLDLVRGHAAIVLGFPGPASVDAERGLLELGFDSLTAVELRNRLG
AATGLRLPATLLFDHPTSGAVARQLAVELAIEDTGPDPAADTAGLAELGRLEGALDSGTA
TPELINRLQELIGRLRPDTGAAAEDRLEERMDTASDDELFEFIDNELGMS
selected fasta
>polyketide synthase [modular polyketide synthase]
ATGCCGGACGAACAGAAGCTTCTTGAGTACCTCAGGCGGGCGACCGCGGACCTCGGGCAG
GCGCGCCAGCGGCTGCGCGAGGAGGAGGACGCCAGGCACGAGCCGATCGCGATCGTCTCG
ATGAGCTGCCGCTACCCCGGTGGCGCCGACGACCCCGAGCAGCTGTGGGACATGGTGTCC
TCCGGCACCGACGCCATCTCCGAATGGCCGGCCGACCGGGGCTGGGACACGGCCGCCCTC
TACGACCCGGACCCCGACCGGCCGGGCACCTCCTACACCCGGCACGGCGGATTCCTGCAC
CGGGCGGGGGAGTTCGACGCCGCGTTCTTCGGCATGTCGCCGCGCGAGGCCCTCGCCACC
GACCCGCAGCAGCGGCTCCTCCTGGAGACCTCCTGGGAGACGCTGGAACGCGCGGGCATC
GACCCGGCGGTCCTGAAGGGCACCGCGACCGGCGTCTTCGTCGGCGCCATGACCAACGGC
TACGGCGACGGCTCCCGGGACCAGTCAGACGTCCAGGGCCTGCTCCACACCGGCACCGCC
GGCAGTGTGATCTCCTACACCCTGGGCCTGGAGGGCCCGGCGGTGACGGTCGACACCGCG
TGCTCGTCCTCGCTGGTCGCCCTGCATCTCGCGATACGGGCGCTGCGCTCCGGCGAGTGC
TCCCTCGCCCTCGCGTGCGGTGTCACCGTCATGCCGCACCCCGACCCCTTCGTCGCGTTC
AGCCGCCAGCGCGCCCTGGCACCCGACGGCCGCTGCAAGGCCTTCGCGGCCGGGGCCGAC
GGCACCTCGTGGTCCGAGGGTGTGGGTGTGCTGCTGCTGGAGCGGTTGTCGGACGCGCGC
CGCCACGGTCGCCGGGTGCTGGCGGTGGTGCGGGGCAGCGCGGTGAACCAGGACGGGGCG
AGCAACGGTCTGACGGCGCCGAACGGTCCCTCGCAGCAGCGGGTGATCCGGGCGGCGCTG
GCGGACGCCCGGCTGCTGCCGGGTGACGTGGACGCGGTGGAGGCGCACGGTACGGGAACC
CGGCTGGGTGACCCGATCGAGGCGCAGGCGCTGCTCGCGACGTACGGCCAGGACCGGCCC
GCCGACCGGCCCCTGCTGCTCGGCTCGCTGAAGTCCAACATCGGGCACACCTCGGCCGCC
GCCGGGGTGGGCGGCGTCATCAAGATGGTCCAGGCGCTGCGCCACGAGGTGCTGCCCCGG
ACCCTGCACGTCGACGCGCCGAGCCCGCAGGTCGACTGGTCGGCGGGCGCGGTCGAACTC
CTCACGGAGGAACGCCCCTGGGCCTTCGACCCCGACCGCCCCCGCCGGGCCGCCGTCTCC
GGGTTCGGCGTGAGCGGCACCAACGCCCACGTGATCCTGGAGGAGGCACCGGAGTCCGCC
GAGACCCCGGAGGCTCCGGAAACCGCCACCCCCCTGCCGCTGGTGCCCTGGGTCCTCTCC
GCCCGTGGCGAGGACGCCCTCACCGACCGGGCCCGCCAACTGCTGGCCCTCGCCGACGCG
GACGCCTTGATACCGGGCGCCGTCGCCCGCGCCCTCGCCACCGGCCGCTCGCCGCTCGAA
CACCGCGCCGTGGTGGTCGCGGGCGACGCCGAGGGATTCCGCACGGGACTCACCGCGCTG
GCGACCGGCGGCGAGGCCGCCAACCTGGTCCGAGGGCTCGCGGGACCCGCCGGCCGGACC
GTGTTCGTGTTCCCCGGCCAGGGGACCCAGTGGACCGGCATGGCCCTCGAACTCCTCGAC
ACCTCACCGGTGTTCGCCGCCCGCATGGCCGACTGCGAGCGCGCCCTCGCCCCGCACGTC
GACTGGTCCCTCACCGACGTCCTGTCCTCCGCCACCGACCTGGAACGCGTCGACGTGGTC
CAGCCCGTGCTGTGGGCCGTCATGGTCTCCCTGGCAGCGCTGTGGCGCTCGGCCGGTGTC
GAGCCGGACGCCGTGCTCGGCCACAGCCAGGGCGAGATCGCCGCCGCAGTCGTGGCGGGT
GCGTTGTCCCTGGAGGACGGCGCAAAGGTCGTCGCCCTGCGCAGCCAGGCCATCACGGCC
ATCGCCGGACGCGGTGGAATGGCCTCCGTCCCGCTGCCGCCGGAGGAGTTGGCCGGCCAT
CTCGGCCCGTGGGGCGACCGGCTGTCCGTCGCCGCCGCCAACGGCCCGGCCGCCACCGTG
CTGTCGGGCGACACCGAGGCGATCGACGGCATCGTGGCCCAGTTGCAGGCCGAGGACGTA
CGGGCCCGCCGCATCCCCGTCGACTACGCCTCCCACTCCGCGCACGTCGAGGAGATCCGC
GAACGGCTCCTGGAGTGCCTCGCGGACATCGAGCCGACGACCGGCCAAGTGCCGTTCTTC
TCCACCGTGGACCTGAACTGGCAGGACTCCGGCGCGCTGGACGCCGAGTACTGGTACCGC
AACCTGCGGCAGACCGTGCGGTTCGAGGAGGCCACCCGCACCCTGCTCGCCCAGGGCTTC
CGCTTCTTCGTCGAGTCCAGCGCCCACCCGGTGCTCACCGTGGGCATCAGCCAGACCGCC
GAGGCCGAGGAGTCCGACGCCGTCGCCGTCGGCACCCTCCGCCGCGACCAGGGCGGCCTG
GACCGATTCCTGCTCTCCCTCGCCGAGGCCCACACCGGCGGACTCGCGCCGGAGTGGGAC
ACCCTGCTCGCCGGGCACCCGGGCGACACCGTCGACCTGCCCACGTACCCCTTCCAGCGG
CGCAGGTACTGGCTGGAACGGCCTTCGGCCCACGCCGAGGACACCGCCGCCACCGACCCG
GCGGACGCCGCCTTCTGGGAGAGCGTCGGCGGACAGGACCTCCCGGCGCTCACCACGACG
CTCGGCGTCCGCCCCGAGGATCCGCTGACGGTCGTCCTGCCCGCCCTGGCCGACTGGCGC
AGGCGGCGCGACGAACGCGCGACCGTGGACTCCTGGCGCTACCGGGTCGACTGGCGGCCC
CTCGCCGACGCCCCGGCCGGCCGCACCGCCGCCGCTCCGAACGGCACCTGGCTGGTGGCG
GTCACCGACGGCACGGAGGGCGACCCGGCGCGGGAAGCCGCGGTCCGGGCGCTGCGCGAG
GCCGGCGCCGTCCCCGTGCCCGTCGTCCTGACCGAGGCGCACACCGACCGGGCCACGCTG
ACCGCGCACCTGTCCGAGGCGAGCACCGGCCCCGTCCACGGCGTCCTCTCCCTCGTCGCC
CTCGACGAGCGCCCCCACCCGAGCCACCCCCACCTTCCCCTCGGCCTCGCGCTCACCCTG
ACGCTCGTGCAGGCCCTGGGCGACGCCGGCGTCACCGCCCCGCTCTGGTGCGCCACCCGG
GGAGCGGTCACGACGGGCCGCGACGACGCGGTGACCAGTCCCGGACAGCACATGGTCTGG
GGCCTCGGCCGGTGTGCCGCACTGGAGCACCCGCAGCGCTGGGGCGGTCTGGTCGACCTG
CCCGACACGCTCGACGAGCGGGCCGCCGCCCGGCTGTGCGGCATCCTGGCCGGCCGGGAC
GACGAGGACCAGGTCGCCGTACGCCCCTCCGGCGCGTACGGCCGACGGCTGGTCCGCGCC
CGGCCCGCCGACCCCGCCCGCGCGGACGCCTGGCAGCCGCGCGGCACGGTCCTGGTCACC
GGCGGCACCGGCGGCGTCGGCGCGCACCTCGCGCGCTGGCTGGCCAAGGGCGGCGCCGAG
CACCTCGTCCTGGTCGGCCGCCGGGGCGCCGACACCCCCGGCGCGGCCGACCTCACCGCC
GAACTGACCGCGCTCGGCACCCGGGTCACCGTCGCCGCCTGCGACGTCGCCGACCGCGAC
CGGCTCGCCGAACTGGTGGCCGGGCTCGAACAGGACGGCCCCCCGATCAGGACCGTCATC
CACGCCGCCGGCACGGGCCTGCTCGTGCCGCTGTCCGACACCGACCCCGACGAGTTCGCC
GACACCCTCTACGCCAAGGTCGCCGGCGCGGAGAACCTCGACGCCGTCTTCGACCGGGAC
GACCTGGACACCTTCGTCCTGTTCTCCTCCATCTCCGGCGTCTGGGGCAGCGGCGACCAC
GGCGCCTACGCCGCCGCCAACGCCCACCTCGACGCGCTCGCGGACCGGCGCCGGGCCCGG
GGCCGCACCGCCACCTCCGTGGTGTGGGGCATCTGGGACCCCGAGGGCGGCGCGGGCATG
GCCGCCAACCTCGTCGAGGAGCAACTGCGCGGCCGGGGCATCCCCTTCATGGCCCCCCAG
GTCGCACTCACCGGGCTCCAGCAGGTCCTGACCGACGACGAGACCGTCGTCCTCGTCACC
GCCGTCGACTGGGACCGCTTCGCGCCCGTGTTCACCTCGGCCCGGCCCAGCCCGCTCATC
GGCGACCTGCCCGAGGTCCGCCGCGCGCTCGCCGAGGAGACCGCGCCCGCCCAGGACGGC
GACGACACCGCCTCCTCGCTGCGCGACCGCATCGCGGACCTGCCCCCCGCCGACCGCGAC
CGCCTGCTCACCGACCTCGTACGCGGCCACGCGGCCGCCGTGCTCGGCCACGGCTCCGCA
GACGCCATCGCCCCCGAACGCGCCTTCCGCGAGCTGGGCTTCGACTCGCTGACCGCCGTG
GAGATGCGCAACCGGCTCAACGCCGCCACCGGTCTGCGGCTCCCGCTCACCGTCCTCTTC
GACTACGCCTCGGCCGACGCGCTCGCCCGGCATCTGCGCGAAGAACTCCTCGGCCCCGAC
ACCGCCGCCCCGACCGGGCCGGCCGTGCCCGCCCATGTGCCCGCCGACGCCGACGACCCG
ATCGCCATCGTCGGCATGAGCTGCCGCTACCCCGGCGACGTCCGCACCCCCGAGGACCTC
TGGCGGCTCGTCGCCGAGGGCCGGGACGTCATCTCCGCACTGCCCGCGGACCGCGGCTGG
GACCTGGACGGCCTCTACGACACCGACCCCGACCGGCCCGGCACGACCTACAGCTCCGAA
GGCGGATTCCTCTACGACGCCGGGCAGTTCGACCCCGCCTTCTTCGGGATCTCGCCGCGC
GAGGCGCTGGCCATGGACCCGCAGCAGCGGCTGCTCCTGGAGACCTCCTGGGAGGCCCTG
GAGCGGGCCGGCATCGACCCCGCCTCCCTGCGCGGCGGACAGGTCGGCGTGTTCGCCGGC
GCCGCCTACCAGGGCTACGGCGGCCTGAGCGACGTACCCGAGGAGGTGGAGGGACACCTC
ATCGCCGGTATCTCCACCAGCATCCTGTCCGGCCGGATCGCCTACACCCTCGGCCTCGAA
GGACCGGCGGTCACCGTCGACACGGCCTGCTCGTCCTCGCTGGTCGCCGTCCACCTGGCG
GCCCAGGCCCTGCGCTCCGGCGAGTGCTCCCTGGCGCTCGCGGGCGGTGTGACCGTCATG
GGCACCCCGCTGTCCTTCACCGGCTTCAGCAGACAGCGCGGTCTCGCCGCGGACGGCCGC
TGCAAGTCCTTCGGCGCCGACGCCGACGGCTTCGGCATGGCCGAAGGCGTCGGACTGCTG
CTCCTGGAGCGGCTGTCCGACGCCCGCCGCAACGGCCACCGTGTGCTCGCCCTCGTGCGG
GGCTCGGCCGTCAACCAGGACGGGGCCAGCAACGGGCTGACCGCCCCCAGCGGCCTGGCG
CAGCAGCGGGTCATCCGCAGCGCGCTGGCCGGCGCGGGCGTGCCCCCGGCCGAGGTCGAC
GTCGTCGAGGCGCACGGTACGGGCACCCGGCTCGGCGACCCGATCGAGGCGCAGGCGCTG
CTCGCGACGTACGGGCAGGACCGCCCCGCGGACCGGCCGCTGCTGCTCGGCTCGCTGAAG
TCCAACATCGGGCACAGCCAGGCCGCCGCCGGCGTCGCCGGGATCATCAAGATGGTCCAG
GCGATGCGCCACGAACTACTGCCCCGCACCCTGCACGCCGAGGTGCCGACCCCCAACGTC
GACTGGTCCGTGGGCGCCGTGGAACTCCTGACGGAGTCCCGGCCGTGGACCCGGGGCGGC
CACCCGCGCCGCGCCGGCGTCTCCTCCTTCGGGCTCAGCGGCACCAACGCCCACGTGATC
ATCGAGGAGCCGTACGACGAGGAGCCCGGGGAGGCGCCCGAGGGCAACGCCCCCGGGACC
GCCGTGCCGTGGCTGCTCTCCGGCCGGACCCCGGAAGCGCTGCGCGAGCAGGCCGCGCGA
CTCCACACCCATCTGACGGACCGTCCGGAACTGCGGCCCCACGACGTCGGCCTCACCCTG
GCCACCGCCAGGTCCGCCTTCGAGCACCGTGCCGTCGTCGTCGGCGCCGACCGGGCCACC
CTGCTCACCGGCCTGGCCGCGCTCGCCGCCGGAGAGAACGACCCCGCCGTGGTGCGCGGC
ACCGCGGCCACCCCGGGCCGTACCGTCTTCGTCTTCCCCGGCCAGGGCTCGCAGTGGGTC
GGCATGGCGGTCGGGCTGCTGGACTCCGCGCCCGTCTTCGCGGAGCGGATCGCCGAGTGC
GAGCGCGCCCTGTCGCCGTACCTGGACTGGTCGTTGACGGACGTGCTGCGGGCCGCCCCC
GACAGCCCGCCACTGGACCGGGTGGACGTGGTCCAGCCGGTGCTGTTCTCCATGATGGTG
TCGCTGGCCGCGCTCTGGCGGTCGTACGGCGTCGAGCCCTCGGCCGTCGTCGGGCACAGC
CAGGGCGAGATCGCCGCCGCCGTCGTGGCGGGGGCGCTGACCCTGGAGGACGGCGCCAGG
ATCGTCGCGCGGCGCAGCCAGATCCTCACCGCGCTGGTCGGCCGGGGCACGATGCTCTTC
GTCGCCCTCCCCGACGAGGAGGTACGCGAACGGCTCGCGCCCTGGGCGGGGAAGCTGTCC
GTCGCCGCCGTCAACGGGCCCGCCGCCGTGACCGTCTCCGGTGACCCCGAGGCCCTGGAG
GAGTTCGGCGAGCGGCTGTCCGAGGACGGCGTGATGCGCTGGACGATCCCGGGCGTCACC
TTCGCCGGACACTCGCCCCAGGTCGACGAGGTGCGCGGGGAACTCCTGGACGCGCTCGCC
GGTGTCGCGCCGCGCCGCACCGACATCGCCTTCTACTCCACCGTGACCGGGGGCGTCGTT
GACACCACGACCCTGGACACCGAGTACTGGTACCGCAACCTCCGTGAGCCCGTCGAGTTC
CACCGGACCGTCGCCGCGCTGATCGAGGACGGCCACGACACCTTCGTCGAGACCGGCCCG
CACCCGGTGCTGACCGTCTGGATCGAACGGAGCCTGGAGGCCGCGGACGTCACCGGCCGG
GTCACCGGCACCCTCCTCACCGACGACGGCGGCCCCGACCGGTTCCTGACCGCCCTGGCC
GCACCGCACGTCCACGGCGTCCCCGTCGACTGGTCCGCCGTGTTCGCGGGCGCCGACGCC
CGACCCGTCGAACTGCCCACCTACGCCTTCCAGCGGCAGCGGTACTGGCTGGAGCCCACC
GCCACGGCCGCCGGCACCGCCGCCGGGGCGCCGGGCGCGGACCGGCCCGGCGACACCGCC
TTCTGGGACGCCGTCGAGCGAGGCGACCTCACCGCCGTCGCCACCGCGCTGAACCTGCCC
GACGAGGACGACAGCGTCCGCACCTCCCTGGGCGGAGTCCTCCCCGCGCTCGCCGACTGG
CAGCGCGGCCGTCGCAGCCGCACCGCCATCGACGGCTGGCGCTACCGCGTCACCTACAAG
ACCCTGCACCCCGCCCCCGGCACCCCCGCCCTCACCGGCACCTGGTGGGTCGTCGTACCG
GCCGACGCGGCCACGCACCCCATGGTGACGGGCGCGCTGCGGGCCCTCGAACGGCACGGC
GCCCTGGCCGTACCGGTCGAGATCGGCGCCGCCGACAACGACCGGGCCGCGCTCGCCGCC
CGGCTGGGCGCCGCGGCCGCCCCGGACGGCGGCGTGCTCTCGCTGCTCGCCCTCGCCGAG
CAGCCGTACACCGACGGGACGGCTCTGCCGACCGGGCTCGCCCTCACCACCACCCTCCTC
CAGGCGCTCGGCGACGCCGGGATCAACGCCCCCCTGTGGTCCGTCACCTGCGGCGCGGTG
TCCGTCGGCCGCTCCGACGCCCTCACCGCACCCGCCCAGGCGACCCTGTGGGGACTCGGC
GCCGTGGCCGGCGTGGAGTACCCGGAACGCTGGGCCGGACTGGTCGACCTGCCGGCCGAC
CTCGACGACCGCTCCGGCGGCCGGCTCGCTGCCGTACTGGCCGGCCTCGACGGCGAGGAC
CAGGTCGCGATCCGGCCCTCGGGGATCTACGGCCGCAGGCTGGTAAGGGCCCTGCCCGGC
GACGAGACGGCCCCGGTCGCCTGGAAACCGGACGGCACCGTACTGATCACCGGCGGCACC
GGCGCCCTCGGCGCCCATGTCGCCCGCAGGCTCGCCCGCTCCGGCACCCGGCACCTGCTG
CTCACCGGCCGACGGGGCCCCGACACCCCCGGTGCCGCCGAACTCGTCGCCGAACTCGCC
GACCTGGGCGCCGAGGCGAGGGTCGCCGCCTGTGACGCCGCCGACCGCGACGCGCTCGCC
GCCCTCCTCGCCGGCATCCCCGACGACCGCCCCCTGCGCGCCGTCGTGCACGCCGCCGGT
GTCCTCGACGACGGCGTCCTCGACACCCTCACCCCCGAACGGGCCGCCGGAGTCCTGCGC
CCCAAGATGGACGCCGCCCGCAACCTGGACGCCCTCACCCGCGACCTGGACCTCAGCGCG
TTCGTCCTGTTCTCCTCGCTCGCCGGCACCCTCGGCGGCACCGGCCAGGGCAGCTACGCC
GCCGCCAACGCCTACCTCGACGCCCTCGCCGAGCACCGGCGCTCACTCGGCCTTCCGGCC
ACCGCCGTGGCCTGGGGCCTGTGGGCGGGGGACAGCGCCGCCAACTCCGCCCGCGAACAG
CTCGTACGCAACGGCATCCCGCCGATGGACCCGGAACTGGCCGTCACCGCCCTCGAACAG
GCCGTGGAACAGGGCGAGAACAGGTTGATCCTCTGCGACTTCGCCTGGGACCGGTTCGCC
CCCGCCTACACCGCGCTGCGGCCCAGCGCCGTCCTGCGCGAACTGCCCGAGGCCCGCGAC
ATCCTGGCCGCCGCCGGGGCCGACGGGCAGGACACCGGGGCGGACTCCCTCGCCGGACGC
CTCGCCGCCCTGTCCGTACAGGAGCGGCAGGAGGAACTGGTCCGGCTGATCCGCACCGAG
GTCGCCGCCGTCCTCGGCTACCCCGACCCCGCCGACGTCGACCCCGACCGTGTCTTCAAG
GACCTCGGCTTCGACTCGCTCACCGCGGTCGACCTGCGCAACCGCCTCTCCGAGGTCACC
GGGCTGCGTCTGTCGGTGACCCTGGTCTTCGACCACCCCACCGTCACCGCCCTGGTGGAC
CACGTACGGTCCGAACTGGGCGGCACGGCACCGGTGTCGACATCCGCCCCGGTGGTGCCC
GACTCGCCGGCCATGCCGGTCGTCGACGACGACGCCATCGCCGTCGTCTCGATGAGCTGC
CGCTACCCCGGCGGTGTCACCACCCCGGAGGAGCTGTGGCGGCTGGTGTCCTCGGGCGCC
GACGCCATCACCGAGTTCCCCACCGGCCGTGGCTGGGACCTCGACGAGCTGTACGACCCG
GACCCGGAGAAGATCGGCCGGACCTACGCCCGCGAGGGCGGATTCCTGCACGACGCCGAC
CACTTCGACCCCGCGTTCTTCGGGATCTCCCCGCGTGAGGCGCTGTCGATCGACCCGCAG
CAGCGGCTGCTCCTGGAGATCTCCTGGGAGGCCTTCGAACGGGCCGGTATCGACCCGGCG
TCACTGAAGGGCAGCAGGGCCGGCGTCTTCGTCGGGTCCAGCTACCGCGACTACGGCTCC
CGCGTCCAGGAGCCCACCGAGGAGACCGAGGGCTACCTCGGCATCGGCAGCGCGGGCAGC
GTCGCCTCCGGCCGGATCTCCTACACCTTCGGCCTGGAGGGCCCGGCGGTCACCGTGGAC
ACGGCCTGCTCGTCCTCCCTGGTCGCCGTGCACCTCGCGGCCCAGGCCCTGCGCTCCGGC
GAGTGCACGCTCGCCCTCGCGGGCGGTGTCACGGTGATGTCCACCCCCGGCGCGTTCATC
GAGTTCAGCAGGCAGCGAGGGCTCGCCGCCGACGGCCGCTGCAAGCCCTTCGCCGAGGCC
GCCGACGGCACCGCCTGGGCCGAGGGCGCCGGCCTGGTCGTACTGGAACGGCTGTCCGAC
GCCCGCCGCAACGGCCACCCGGTGCTCGCCCTGGTCCGCGGCTCGGCCGTCAACCAGGAC
GGCGCCAGCAACGGCCTCACCGCCCCCAACGGACCCTCCCAGCAGCGCGTCATCCGGCAG
GCACTCGCCTCCGCCGGGCTGAATAGCGCGGACGTCGACGCGGTGGAGGCGCACGGTACG
GGCACCCGGCTCGGCGACCCGATCGAGGCGCAGGCACTGCTGGCGACGTACGGCCAGGAC
CGGCCCGCCGACCGGCCGCTGCTCCTCGGCTCCCTCAAGTCCAACATGGGACACGCCCAG
GCCGCCGCCGGTATCGCGGGCCTGCAGAAGATGGTGCTGGCCATGCGGCACGGAGTCCTG
CCGCGCACCCTCCACGTCGACGCGCCGACCCCGTTCGTCGACTGGTCGGCGGGCGCCGTG
TCGCTGCTCACCGAGGACACCCCGTGGCCGGACAACGGCCACCCGCGCCGCGCCGGCATC
TCCTCCTTCGGCGTGAGCGGCACCAACGCGCACACGATCCTGGAACACGTACCGGACGAG
TACGCCCCGGACGGCCTGGACGAGGCCGGTGATGACGCCGCTGACGACGGGACCGTCCTG
CCGTGGCTGCTGTCGGCCCGCAGCCGGGCCGCGCTGCGCGCCCAGGCCCAGCGGCTGCTG
GAGCACACCGACGCCCGGCCCGGCCTGCGCCCGGCCGACATCGCGCACACCCTGGCCACC
GGCCGCAGCGCCTTCGAGTACCGGGGCGCCGTCGTGGGCGACAGCCGCGAGGCCCTGACC
GGCGGACTGAAGGCACTCGCCACCGGCGGAAGCGCGCCCGGCGTCACCCAGGGCACGGCC
GTGGCGGGGAAGGTCGCCTTCCTCTTCGCCGGACAGGGCAGCCAGCGCGCCGCGATGGGC
GCCGAACTGTACGCCCGGTACCCCGTGTTCGCGGACGCCTTCGACGAGATCTGTGCCGAA
CTGGACCCGCTGCTCGACCGCCCGCTGCGCGAGGTCGTCTTCGCCCCGGCCGGTTCGGAC
GCGGCGGCCCTCCTGGACCGTACGGAGTACACGCAGCCCGCGCTCTTCGCCGTCGAAGTC
GCCCTCTTCCGGCTGGTCGAGCACTGGGGCGTGGTACCGGACCTGCTGCTCGGCCACTCC
ATCGGCGTACTGGCCGCCGCCCACGTCGCGGGGGTCTTCACCGCGCCCGACGCCGCCGCG
CTGGTCGCGGCCCGGGGCCGGCTGATGCAGGCACTGCCCGAGGGCGGCGCCATGGTCGCG
CTCACCGCGTCCGAGGCGGATGCCACGGCGCTCCTGGCCCCCTACGACGGCCGCGTCGCG
GTGGCCGCCGTCAACGGGCCGGCCTCCGTCGTCGTCTCCGGCGACGAGGACGCCGTCCTC
GACCTCGCCGAACAGTGGCGCGACCGGGGCGGCAAGGCCCGTCGGCTCACCGTCAGCCAC
GCCTTCCACTCGCCGCACATGGACGCCATGCTCGACGAGTTCCGGCGGGTCGCCGAGAGC
CTGGACTACCGGGCGCCGCGCATCCCGCTGGTCTCCGACGTCACCGGCGAACTCGCCACC
CCCGAGCAGCTGGGATCGCCCGAGTACTGGGTGCGGCACGTCCGTGAGGCGGTGCGCTTC
CACGACGGCATGCGGCGGCTCGCCGCCGAGGGCGCCGTCACCTACCTCGAACTGGGCCCC
GACGGCTCGCTGACCGCCATGGGACGCGACTGCTTCGCCGAAGCCGACCCCATCGGCTCC
GACGACCCGGTGGACCCGTCCGCCGCCGGCCCCCTCGTGCCGCTGCTGCGCAAGGACCGC
ACCGAGACCCGGGCTCTCACCGACGCCCTCGCCCAGCTGTACGTCCGGGGCACCGCCGTC
GACTGGCCCACGGTCCTGGAAGCCACCGGCAGGGGCGGCCAGGTCGAACTGCCCACCTAC
GCCTTCCAGCGCGAGCGCTACTGGCTGGAGGCCACCGCGGCATCCGGAGGCATGGCCGCC
GCTGGGCTCCTGCCGGCGGACCACCCGCTGCTCGGCGCCGCCGTCCCGCTCGCCGACACC
GACGGAGTCCTGTTCACCAGCAGGCTCTCCGTACGCACCCACCCCTGGCTGGCCGACCAC
GGTGTCTTCGGCACCGCCCTGTTCCCCGCCACCGCCCTGCTGGAACTGGCGGTCCGGGCC
GGCGACCAGGTCGGCTGCGGCCAGGTCGAGGAACTCACCCTGGAAACCCCGCTGGTGATC
CCCGCACAGGGCTCGGTGGCACTGCAACTGACCGTCGGCGCCCCGGACTCCACCGGCGCC
CGCCCGCTCAGCGTCCACACCCGCCCGGGAGACACGGACGACATGGGCTGGACCTGCCAC
GCCCGGGGGCTGCTCGTTCCCGCCGCCGACGAGACGGAACCGGCCGACTCCGTGACCTGG
CCGCCGACGGGCGCGCAGCCCGTGCGGATCGACGGGCTGTACGAGCGGTTCGCGGAGGGC
GGCTTTGGATACGGGCCCGCCTTCCAGGGGCTGCGCGAGGTGTGGCGGCTCGGCGACGAC
GTGTACGCGGAGGCGAGCCTGCCGCCCGAACAGCAGGCCGAGGCCGCGAAGTTCGGGCTG
CACCCCGCGCTCCTCGACAGCGCCCTGCACGCGCTGATCTTCGGTGTCCTCGAAGGGACC
GACCAGGGGTGGCTGCCGTTCTCCTGGAACGGCATACGCCTGCACGCCTCCGGGGCCCGC
GCCCTGCGCATCCGACTGACCCCCGCGGGCAACAACGCGGTCTCCGTCCAGGCCACCGAC
ACGGCCGGACAACCGGTCGTCTCCATCCGCTCCCTGGTGCTCCGCCCGGTCAACCCCGAC
CAGGTACGCGCCGCCCGGACCGCGCACCACGACGACCTGTACCGCGTCGAATGGCCCACG
CTGTCCCGGCCGGCCGCCGCCGACTCCGACGGCTGGGCCGTCATCGGACCCGAGGCACCC
GACTGGGCGGCCCACGGCATCACCCGCTCCGCCACCGGCCTGGAAGCGCTGTCCCGCGAG
ATCGCCGGGGAAGCCGGGGGAGTGGCTCCGCCCACGGTCGTCCTCGCGCACGTCCCCGCC
GCTCCGGCCGGACTCGGGCAGCCCGACGCGGTACGGCACGTCACCGGGCACACTCTCACC
CTCGTACAGGAGTGGCTGGCCGACGACACGTTCGCCGACGCCAAGCTGGTGCTCGTCACC
CGGGGCGGCGTCCCGGTGAGCGCCGACGGGGTCGCACAGGACCTGGCCCACGCCGCCGTG
TGGGGGCTGGTGCGGTCCGCGCAGACCGAGAACCCGGGCCGTTTCGTCCTCGCCGACCTC
GACGACGCCTCCGAGGACGCGCTCGTCGCCGCCGTAGCCAGTGGCGAACCCCAACTCGCC
CTGCGTGAGGGCCGGACGCACATCGCCCGGCTGACCAAGGTGCCCGTCACCGAACAGCCC
GGGACACCCGACTGGGGACGCCCCGGCACGGTGCTGATCACCGGCGGCACCGGCGCCATC
GGCTCCGTCCTCGCCCGGCACCTGGCGGCCGAGCACGGTGTGAAGCGCCTGCTGCTCACC
AGCCGCCGGGGCCCTGCCGCCGAGGGCGCCGCCGACCTGGTCGTCGAACTCGCCGCACTC
GGCGCCCACGCGGAGATCGTGGCCTGTGACGCCGCCGACCGGGACGCGTTGGCCCGGCTG
CTCGGCGCGCTGCCCGAGGACCAGTCGCTGACCGCCGTGGTGCACGCCGCGGGCACGATC
GCGGACGGCGTCGTCGACGCGATGACACCCGTCCGGCTGGACACCGTCCTGCGGCCCAAG
GTCGACGCGGCCTGGAACCTGCACGAGCTGACCGAGGGCATGGACCTGTCCGCGTTCGTC
GTGTTCTCCTCCATCGCCGGTGTCTTCGGCGGCATGGGCCAGGGCAACTACGCGGCCGCC
AACTCCTTCCTGGACGCGCTCGCCCACCACCGCCGGCAGCGCGGCCTGCCCGCCGCGTCC
CTCGCCTGGGGCCTGTGGGCCAACAAGGGCGGCATGAGCGGAGGTCTCGACGAGGCGGAC
TTCCGGCGCATCGCCCGGGGCGGCATCATCGCCTTCTCCCCGGCCGAGGGCGCCGCCCTC
TTCGACACGGCCAACGCCTCCAGCGAACCCGTCGTCCTGCCCCTGCGCCTCGACACCACC
GCCCTGGCCGCCCAGAGCGGCGCCGACGGAGTCCCCGCCCTGCTGCGTGGACTCGTACGC
CCGGCGGCGCGCCGCAGCGCGGCGGCCGGCGAGGCGGCACCGGACGCGGCCGACACCCTC
CGGCGCACCCTCGCCGGACAGCCCGAGCACCGGCGGCTGCGCACCCTGCTCGACCTGGTG
CGCGGGCACGCCGCCATCGTGCTCGGCTTCCCCGGCCCCGCCTCGGTCGACGCCGAACGC
GGACTGCTGGAACTCGGCTTCGACTCGCTCACCGCCGTCGAACTGCGCAACCGGCTCGGC
GCCGCCACCGGCCTGAGGCTGCCCGCCACCCTGCTCTTCGACCACCCCACGTCCGGTGCC
GTCGCCCGCCAGCTGGCCGTCGAGCTGGCCATCGAGGACACCGGCCCCGACCCCGCCGCC
GACACCGCGGGACTGGCCGAACTCGGCCGCCTCGAAGGCGCCCTGGACAGCGGCACGGCC
ACCCCCGAGCTGATCAACCGGCTCCAGGAACTCATCGGCAGGCTGCGCCCGGACACCGGT
GCCGCGGCCGAGGACCGCTTGGAGGAGCGGATGGACACGGCCAGCGACGACGAGCTCTTC
GAGTTCATCGACAACGAACTCGGCATGTCGTGA
[5] KS34..405
[5] AT561..876
[5] methylmalonyl-CoA749..753
[5] KR1195..1375
[5] ACP1483..1553
[6] KS1579..1953
[6] AT2109..2428
[6] methoxymalonyl-ACP2292..2305
[6] KR2752..2931
[6] ACP3033..3103
[7] KS3131..3507
[7] AT3667..3999
[7] malonyl-CoA3860..3864
[7] DH4048..4211
[7] KR4529..4709
[7] ACP4816..4886
[5] KS100..1215
[5] AT1681..2628
[5] methylmalonyl-CoA2245..2259
[5] KR3583..4125
[5] ACP4447..4659
[6] KS4735..5859
[6] AT6325..7284
[6] methoxymalonyl-ACP6874..6915
[6] KR8254..8793
[6] ACP9097..9309
[7] KS9391..10521
[7] AT10999..11997
[7] malonyl-CoA11578..11592
[7] DH12142..12633
[7] KR13585..14127
[7] ACP14446..14658

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [557-681]  G3DSA:3.40.366.10 [749-864]  G3DSA:3.40.366.10 [2099-2232]  G3DSA:3.40.366.10 [2301-2418]  G3DSA:3.40.366.10 [3659-3792]  G3DSA:3.40.366.10 [3860-3989]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1511-1526]  PS00012 [3061-3076]  PS00012 [4844-4859]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1476-1595]  1.20000117458134e-28 SSF47336 [3026-3147]  1.10000150671642e-29 SSF47336 [4808-4903]  4.00000300869883e-19 SSF47336
SSF47336   ACP_like
 [1483-1553]  PS50075 [3033-3103]  PS50075 [4816-4886]  PS50075
PS50075   ACP_DOMAIN
 [1486-1552]  1.4e-11 PF00550 [3036-3102]  7.5e-16 PF00550 [4820-4884]  2.3e-10 PF00550
PF00550   PP-binding
 [1483-1556]  1.29999999999998e-65 G3DSA:1.10.1200.10 [3030-3108]  1.29999999999998e-65 G3DSA:1.10.1200.10 [4815-4888]  1.29999999999998e-65 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1195-1373]  2.89999999999999e-62 PF08659 [2752-2930]  3.60000000000002e-64 PF08659 [4529-4708]  9e-63 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-279]  6.70000000000006e-90 PF00109 [1579-1828]  5.09999999999992e-96 PF00109 [3131-3381]  8.70000000000003e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [287-405]  1.40000000000001e-46 PF02801 [1836-1953]  6.40000000000004e-46 PF02801 [3389-3507]  8.1e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [561-876]  9.3000000000001e-112 PF00698 [2109-2428]  6.49999999999992e-103 PF00698 [3667-3999]  3.60000000000002e-62 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  2e-12 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [559-858]  1.50000965748778e-65 SSF52151 [2107-2399]  2.50000909916183e-70 SSF52151 [3664-3994]  1.3000049540733e-68 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [683-748]  1.99999636034521e-18 SSF55048 [2234-2300]  3.89999861795218e-15 SSF55048 [3794-3859]  1.60000240695997e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [34-290]  G3DSA:3.40.47.10 [291-459]  G3DSA:3.40.47.10 [1581-1840]  G3DSA:3.40.47.10 [1841-2004]  G3DSA:3.40.47.10 [3131-3391]  G3DSA:3.40.47.10 [3393-3559]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-403]  2.50000909916183e-102 SSF53901 [1571-1943]  2.50000909916183e-104 SSF53901 [3123-3559]  1e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1195-1394]  1.29999999999998e-103 G3DSA:3.40.50.720 [2752-2937]  1.79999999999997e-107 G3DSA:3.40.50.720 [4529-4711]  1.79999999999997e-107 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [192-208]  PS00606 [1741-1757]  PS00606 [3294-3310]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [563-857]  3.79997359309398e-120 SM00827 [2111-2409]  1.59998835313644e-116 SM00827 [3668-3980]  1.39999277195148e-127 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1484-1556]  1.79999754022375e-33 SM00823 [3034-3106]  1.10000150671643e-36 SM00823 [4817-4889]  5.39999384454126e-30 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [4048-4211]  1.3000049540733e-87 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-458]  SM00825 [1581-2006]  SM00825 [3133-3559]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1195-1375]  1.10000150671643e-57 SM00822 [2752-2931]  5.59999989417026e-61 SM00822 [4529-4709]  1e-60 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit