close all open/close all

CDS information : Conca_00080


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction55,779 / 70,799 / + [in whole cluster]
55,779 / 70,799 / + [in contig]
Location55779..70799 [in whole cluster]
55779..70799 [in contig]
TypeCDS
Length15,021 bp (5,006 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)modular polyketide synthase
GeneconE
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • CONE
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)

close this sectionPKS/NRPS Module

10 ethylmalonyl-CoA
11 methylmalonyl-CoA
12 methylmalonyl-CoA
KS36..405
AT596..922
KR1242..1422
ACP1531..1601
KS1624..2000
AT2167..2492
KR2811..2990
ACP3102..3172
KS3196..3572
AT3728..4042
DH4085..4250
KR4566..4746
ACP4852..4922

close this sectionSequence

selected fasta
>polyketide synthase [modular polyketide synthase]
MSDRTEQKLRDYLNRVTIDLQQTRRRLRDVEERSREPIAVVAMSCHFPGGVHSPEDLWEL
VADGRDTYSGIPADRGWDTTGLAGSGVPVTGAFLDEAGGFDPAFFGISPREALAMDPQQR
LMLQTCWEAVERGGIDPVSLRGSRTGVFAASIDQGYMSLADGAPEGVQGFLMTGNAISVM
SGRVSYVMGLEGPSVTVDTACSASLVALHLAAQSLRNDECSLALVGGVNVMALPGAFVEI
SRQGGLAADGRSKPFAAAADGTGWGEGVGVLLVERLSDARANGHPVLAVLRGSAINQDGA
SNGLTAPNGPSQQRVIRAALADAQLAPADVDAVEAHGTGTRLGDPIEADALLAAYGQDRA
EDQPLWLGSIKSNIGHTQAAAGLAGVIKVVMAIRHGVLPQTLHVDAPTPHVDWSSGGVRL
LTERRDWPVAGRPRRAGVSSFGMSGTNAHVIIEQASEAEQRPAAEQAPEGGRQGAAEPIA
GAGPRTAPDAGSGVASGSASGVDPLPTVPWPLSGRSPEALRDQAARLASWLADRPGLRPA
DVGHSLATTRSAFEHRAVVVADRPEGFLRGLAAVAAGTSAAETVSGRTGAGDGRTVFVFP
GQGSQWAGMARQLLDESPVFAARMAECEQALAPHLDWSLSAVVRGEPDAAPLDRIDVVQP
VLFAVMVSLAAVWRSYGVEPDAVVGHSQGEIAAAYVAGALSLDDAARIVAVRSRAQLGLS
GTGGMASVALPADTLRESLCAWEGRLSVAAVNGPASAVVSGDPEALEEFLRQCEEREVRT
RRVAADVAGHSAHMDRLRDGMLDALADVRPTAATIPFCSTVTGGSLDTTGLDAGYWFRNM
RQTVEFDAAVRDLVRRGHSVFVEISPHPVLTVPTQDTLDDLADPDAAVPAPPTLVTGTLR
RDEGGLHRVLTALAQVHVHGVPVDWTAVFAGHRPERVELPTYAFQNRRFWLEPQTRPGTA
PETADPADAAFWAAVEREDVAAVAATLGVEAASWSDILPALSAWRRDRRDRAVLDGWRYH
ISWQRLTAKTAGPLRGRWPVLVPDGHTADAAVTRAVEALRERGANPELVVLDHTHTDRSR
LTDHLRELLATGPGTETAPSGVLSLLALDERPHEGLPALPVGLALTTALVQALDDLDVRT
TLWCATSGAVPVHPSEPVPHPVQALVWGFGRTAALEHPSLWGGLIDLPEQCDERAGHLLG
DLLAGAGDEDQLAIRASGAHARRLVRATPSTSAPSAPWRPSGTVLVTGGTGGLGAHAARW
LARGGADHLVLVSRRGADAPGADELAAELTALGTGVTLAACDITDREALAALVDRVAADG
HPVRAVLHTAAAAQLFPVRDENPASMAATLAAKVQGAANLDAVLADTDLDAFVLYSSVSG
VWGSADHAAYAAGNAYLDALAAHRRGRGLAATSVVWGIWSAEGGGLATSDLERALLERGI
PFMDPRLAVGGLQRVLDDDETVVVVADVDWARFVPVFTSVRPSPLIADLPDVRALATAED
RTEPDPGDTDGASALRRTLAGLTEPEVRRTLLELVRTNAAAVLGHESADAVLPDRAFREL
GFDSLIAVELRNRLNQVTGLRLRATVVFDYSCAALLAEHLRTELLGDTAPAAAPAAVVPV
ADPDEPIAIVAMSCRFPGGIDTPERLWQLLVDGGEVLSGMPADRGWPLDRLYHPDPDHPG
TSYVREGSFLHDAGDFDPAFFGISPREAVAMDPQQRLLLETSWEAFERAGIDPASLRTTP
TGVFAGVNYQDYTSLAGSSPEGGEGHLVAGGAASVVSGRVAYTLGLEGPAVTVDTACSSS
LVATHLAAQALRGGDCSLALAGGVAVMATPGVFVGFSRQRGLAADGRCKAFGASADGMGL
AEGVGVVLLERLSDARRNGHPVLAVLRGSAVNQDGASNGLSAPNGLAQQRVIRQALTNAG
LTGADVDVVEAHGTGTTLGDPIEADALLATYGQDRPHGRPLWLGALKSNIGHTQAASGVA
GMIKTVLSLRHGVLPRTLHADEPSPHVDWASGEVELLTEARDWPDTGAPRRAGISSFGFS
GTNVHAILEQAPPASDADADAETDADAGPEPRHAPTAPVVPWVLSARSPQALTHQAQRLR
GHLAGGGAPDPLDTGYSLATGRTPFEHRAVLLGTGGDAPSAALDGLAGGEDTPGLIRGVA
DTDGRRVFVFPGQGAQWAGMAVELLDTSPVFAASMAACEQALTPYVDWSLDAVLRGAPDT
PPFERVDVVQPALWAVMVSLAAQWRSWGVEPDAVLGHSQGEIAAAVVAGALSLDDGAKVV
ALRSRAILALAGHGGMVSVAVPRERAVELVARWSGRLSLAAVNGPSAVVVSGDTEALTEL
IAVCEEDGVRARTIAVDYASHSAHVERIRAEVLGALDGITPVAGRVPLYSTLTGDWLDTT
EMDAGYWYRNLRETVEFDGAVRALADQRHQVFVEVSPHPVLTMSVQETIESATAAESAEA
PRTVVTGTLRRDEGGLARALTSAAELWVRGVPVLWPVLFEGTGARRTDLPTYPFEHRRYW
LQSAEPAAPSGTADETDAVDSAFWRLVERGDAAEAAGDLAVDAETLGTVLPALNAWRRRQ
REGAAVDTWRYRVDWQPVPDPPAASLSGTWLVVLPEGHDDAPGAPLARDSVTALTEAGAD
VVTVRLTDADADRATLGERLTTALEGRTPQGVLSLLAIAGRPHPDHPAVSAGSALTLVLV
QALGDLGVEAPLWCATHGAVTTGDTDTLSAPDQALIWGTGMVAALEHPTRWGGLVDLPPS
LNSLSRDRLRAILAGATGEDQLAVRSVGLLGRRLVRAPRPSGTRPAWKPRGTVLVTGGTG
ALGPHVARWLARGGAEHLVLPGRRGADVPGADELRAELAELGTELSLPACDVADRDQIAG
LLAGLEEQGTPVTAVFHAAAYIQLASLDDTPLDAFAEVVAAKAEGARHLDELLDRELDAF
VLFSSVAGVWGSSNHAAYTAGNAYLDALAEHRRARGLSATTVDWGVWSAANPWAVRETVD
ESDFYRVQKQGLPLIEPDLALAGLQQALDDDETVIALANVDWEQFAAVFGSVRPSRLLTG
VPEARRQLEEAATPGASAATPASDVLRERLTGLAEAEQRRVTLDLVRTHAAAVLGHDSPE
ELRPGRAFQELGFDSLTAVELRNRLRAATGLTLPATLVFDYPSAAVLADHIRAEVLGEHR
TPATREPAPAGTAAADEPIAIIAMSCRFPGGVHTPEQLWRLLEEGGDVVSEFPTDRGWPL
EAMFDPDPDQPGTSYVRHGGFLYDAGEFDADFFGISPREAVAMDPQQRLLLETSWETFER
AGLDPDRLRGTDTGVFTGVNYQDYGASVAQTQENEGHLLTGSAASVISGRISYTLGLEGP
AVTVDTACSASLVAVHLAAQALRAGDCSLALAGGVAVMSSPGAIISFARQRGLAADGRCK
AFSDAADGMGMAEGVGVILLERLSEAQRHGHPVLAVLRGSAVNQDGASNGLTAPNGPSQQ
RVIRAALANARLSAADIDVVETHGTGTRLGDPIEAQALLATYGQERSDGRPLLIGSLKSN
IGHAQAAAGVAGVIKTVLALRHGQVPRTLHVDRPSTQVDWTAGAVDVVTDTTPWPVTGRP
RRAGISAFGMSGTNVHAIVEQAPEPAPEESPRDTPDEVPAGTVAWPLSAKSPDALRGQAE
RLTAHLADTPGLPPADIGRALTTRTAFEHRAVLVGDGTRLPAALTALADDGTAPDLVRGV
ADTVGRTVFVFPGQGSQWAGMARELLDESPVFAARMEECERALAPFVDWSLLDAVRSGSA
WDRVDVVQPALFAVMVSLAEVWRSFGVVPDAVVGHSQGEIAAAVVAGALSLEDGAQVVAL
RSKTLDALAGRGGMASLSLPADQAREALAPWAGALSVAALNGPATTVVAGDAEALAALLA
QCEAQGVRARRIDVDYASHSEHVEEIHGILMDALAGIKPLPSEVPLYSTVDGGWLDTTGM
HAGYWYRNLRQTVGFDPAVRVLAAEGFTSFVEVSPHPVLTMAIEETTETAGREAVVLGTL
RRDEGGLRRVLLSAAELWVRGGAVDWTAAFPGESTAELPTYAFQRRRYWIQPPAATPRGP
GATGHPLLGTAVEVADTGDLVLSGSLSTRTHPWLADHAVSGVVLLPGTGFVELAVRAGDE
ADCPRVEELTLQAPLVFDRDAAVQIQVRVGAPDESGRRTLGVFSRGEDGAGTPWTGHATG
VLAPAGSTDPAAHPYGAAWPPAGAEPVSVDGLYERFADAGYGYGPAFHGLHAAWRLGQDV
YVEVRLPEDLHTGAAGFGLHPALLDAALHGLWLAAPEGADQNDEPGTARLPFSWEGVRLH
ASGATELRVRLSYDDTGSVALSAADPAGRPVADVAALAIRPIAVDALRGAAAQGRDSLFT
LGWTALPATTEPPVGRWAALGTEHLLPETHENLDALTAAVDGDAAVPDVVVTLCPPGGNS
ADAARTALAATLRLLQTWLADDRWADTRLVLVTRGGVATARGEDIGDLAAAAVWGLVRSA
QSEHPDRFVLVDAEDPAEALKALPAALSATEPQLAVRDGRTLAPRLTRTPPTDAEAVAGK
PWDPEGTVLVTGAFGVLGGLVARHLVTEHGVRHLLLTGRRGADTPEATALVDELTALGAR
VETAACDTADRDALAGLLAGVPDTHPLTAVVHSAGVLDDGVIGSLTPERLDHVLRPKADA
ALNLHELTRDLPLAAFVLFSSASGTVGSSGQGNYAAANAFLDALAQHRRAQGLPAQSIAW
GMWAERSTLTGTLDEVDLRRIARGGVGALTSDEGLALFDAALERDDAVLVPVRLDLARLR
SRAGTGAVPALFRSLVRGAARRTAATGGAADAADTLRGRLAGLAADDARAVLADLVCAHA
ADVLGHAGASAVDPERAFRQLGFDSLTAVELRNRLNAATGLRLPATLVFDYPSPAAVAGY
CAERLAPAGTPPAAAAPTPADDEITRALSTIPLDRLRDSGLLEALLRLAGPENRDGGTPA
SSERTSGIEEMDVDGLVRLALGSESV
selected fasta
>polyketide synthase [modular polyketide synthase]
GTGAGCGACCGGACCGAGCAGAAGCTCCGCGACTACCTCAACCGCGTCACCATCGACCTC
CAGCAGACCCGGCGACGGCTGCGGGACGTCGAGGAGCGCAGCCGTGAGCCCATCGCCGTC
GTCGCGATGAGCTGCCACTTCCCCGGCGGGGTGCACAGTCCGGAGGACCTGTGGGAGCTG
GTGGCGGACGGCCGCGACACCTACTCCGGGATCCCCGCCGACCGGGGCTGGGACACCACC
GGGCTGGCCGGCTCCGGCGTCCCCGTCACCGGGGCCTTCCTGGACGAGGCCGGCGGCTTC
GACCCGGCCTTCTTCGGCATCTCGCCCCGCGAGGCGCTCGCCATGGACCCGCAGCAGCGG
CTGATGCTCCAGACCTGCTGGGAGGCCGTCGAACGAGGCGGCATCGACCCCGTGTCGCTG
CGCGGCAGCCGTACCGGCGTGTTCGCCGCCTCCATCGACCAGGGCTACATGTCGCTGGCC
GACGGCGCGCCCGAGGGCGTCCAGGGCTTCCTGATGACCGGCAACGCGATCAGCGTCATG
TCCGGGCGCGTCTCCTACGTCATGGGCCTGGAAGGGCCCTCGGTCACCGTCGACACCGCC
TGCTCCGCCTCGCTGGTGGCGCTGCACCTCGCGGCGCAGTCGCTGCGCAACGACGAGTGC
TCGCTCGCGCTCGTCGGCGGCGTCAACGTGATGGCCCTGCCGGGCGCCTTCGTGGAGATC
TCCCGCCAGGGCGGCCTCGCCGCCGACGGCCGCAGCAAGCCCTTCGCGGCGGCGGCCGAC
GGCACCGGCTGGGGCGAGGGCGTCGGCGTGCTGCTCGTGGAGCGCCTCTCCGACGCCCGC
GCCAACGGCCACCCGGTCCTCGCGGTGCTGCGGGGCAGCGCCATCAACCAGGACGGCGCC
AGCAACGGCCTGACCGCCCCCAACGGTCCCTCGCAGCAGCGCGTGATCCGCGCCGCGCTC
GCCGACGCCCAGCTGGCACCGGCCGATGTCGACGCCGTCGAGGCGCACGGCACCGGCACC
CGGCTCGGCGACCCCATCGAGGCCGACGCCCTGCTCGCCGCCTACGGCCAGGACCGCGCC
GAGGACCAACCGCTGTGGCTCGGCTCGATCAAGTCCAACATCGGCCACACCCAGGCCGCG
GCGGGCCTGGCCGGTGTCATCAAGGTCGTCATGGCGATCCGGCACGGCGTCCTGCCGCAG
ACCCTGCACGTGGACGCGCCCACCCCGCACGTCGACTGGAGCTCCGGCGGCGTGCGGCTG
CTCACCGAACGCCGCGACTGGCCCGTCGCGGGCCGCCCGCGCCGCGCGGGCGTCTCCTCG
TTCGGCATGAGCGGCACGAACGCGCACGTCATCATCGAGCAGGCATCCGAGGCCGAGCAG
CGGCCCGCCGCCGAGCAGGCGCCCGAGGGCGGTCGGCAGGGCGCGGCCGAGCCGATCGCC
GGCGCCGGGCCGCGTACCGCGCCGGACGCCGGGTCCGGTGTTGCGTCCGGTTCCGCGTCC
GGCGTGGACCCCCTGCCGACCGTGCCCTGGCCGCTGTCCGGCCGCAGCCCGGAGGCGTTG
CGCGACCAGGCGGCCCGGCTCGCCTCCTGGCTCGCCGACCGGCCCGGACTCCGCCCTGCC
GATGTCGGCCACTCGCTCGCGACCACCCGCTCCGCCTTCGAGCACCGGGCCGTCGTCGTG
GCCGACCGGCCCGAGGGCTTCCTGCGCGGGCTCGCCGCCGTCGCGGCGGGCACCAGCGCC
GCCGAGACGGTCAGCGGCCGGACCGGCGCGGGCGACGGCAGGACCGTCTTCGTCTTCCCC
GGCCAGGGCTCGCAGTGGGCTGGCATGGCACGGCAACTCCTGGACGAGTCACCGGTGTTC
GCCGCCCGCATGGCCGAGTGCGAACAGGCCCTCGCCCCGCACCTGGACTGGTCGCTGTCG
GCGGTCGTGCGCGGCGAGCCCGACGCGGCGCCGCTGGACCGCATCGACGTCGTCCAGCCG
GTGCTGTTCGCGGTGATGGTCTCCCTCGCCGCCGTGTGGCGGTCGTACGGGGTCGAACCC
GACGCCGTCGTGGGCCACTCCCAGGGCGAGATCGCCGCCGCGTACGTCGCCGGCGCCCTG
TCGCTCGACGACGCCGCCCGCATCGTCGCCGTACGCAGCCGCGCCCAGCTGGGACTGTCC
GGCACCGGTGGCATGGCCTCCGTGGCGCTGCCCGCCGACACCCTGCGGGAGAGCCTGTGC
GCCTGGGAGGGCCGTCTGTCGGTCGCCGCCGTCAACGGCCCGGCCTCCGCGGTCGTCTCC
GGGGATCCCGAGGCCCTGGAGGAGTTCCTCCGCCAGTGCGAGGAACGCGAGGTGCGGACC
CGGCGGGTCGCCGCCGACGTGGCGGGCCACTCCGCGCACATGGACCGGCTGCGCGACGGC
ATGCTCGACGCGCTCGCCGACGTCCGGCCCACCGCCGCCACGATTCCGTTCTGCTCGACG
GTGACCGGCGGATCCCTCGACACGACCGGCCTGGACGCCGGCTACTGGTTCCGGAACATG
CGGCAGACCGTCGAGTTCGACGCCGCCGTGCGCGACCTCGTCCGGCGCGGCCACAGCGTC
TTCGTCGAGATCAGCCCGCACCCCGTGCTCACCGTGCCGACGCAGGACACCCTCGACGAC
CTCGCCGACCCCGACGCGGCGGTCCCGGCCCCGCCGACCCTGGTCACCGGCACCCTGCGC
CGCGACGAGGGCGGCCTGCACCGGGTGCTCACCGCCCTCGCCCAGGTGCACGTGCACGGC
GTGCCGGTGGACTGGACGGCCGTGTTCGCCGGGCACCGGCCCGAGCGGGTCGAACTGCCC
ACGTACGCCTTCCAGAACCGGCGCTTCTGGCTGGAGCCGCAGACCCGGCCCGGCACCGCG
CCGGAGACCGCCGACCCCGCGGACGCCGCCTTCTGGGCCGCCGTCGAACGCGAGGACGTC
GCCGCGGTCGCCGCCACGCTCGGCGTCGAGGCCGCCAGTTGGAGCGACATCCTGCCCGCC
CTCTCCGCCTGGCGCCGCGACCGCCGTGACCGGGCCGTCCTCGACGGCTGGCGCTACCAC
ATCTCCTGGCAGCGGCTCACGGCCAAGACCGCCGGACCGCTGCGGGGCCGCTGGCCGGTC
CTCGTCCCGGACGGCCACACCGCCGACGCGGCGGTGACCCGTGCCGTCGAGGCCCTGCGC
GAGCGCGGCGCCAACCCCGAACTCGTCGTCCTCGACCACACCCACACCGACCGGTCCCGG
CTCACCGACCACCTGCGCGAACTGCTGGCCACCGGGCCCGGCACGGAGACCGCCCCCTCC
GGAGTGCTGTCCCTGCTGGCCCTCGACGAGCGGCCGCACGAGGGCCTGCCCGCCCTGCCC
GTCGGCCTGGCGCTCACCACCGCGCTCGTCCAGGCGCTGGACGACCTCGACGTCCGGACC
ACGTTGTGGTGCGCCACCTCCGGCGCCGTCCCGGTGCACCCGTCGGAGCCGGTGCCCCAC
CCGGTCCAGGCCCTCGTCTGGGGCTTCGGCCGCACGGCGGCGCTGGAGCACCCGAGCCTG
TGGGGCGGTCTGATCGACCTGCCCGAGCAGTGCGACGAGCGCGCCGGGCACCTGCTCGGC
GACCTGCTGGCCGGAGCCGGCGACGAGGACCAGCTCGCGATCCGGGCCTCCGGCGCCCAC
GCCCGCCGACTGGTCCGCGCCACCCCCTCCACCTCCGCGCCGTCGGCTCCCTGGCGGCCC
TCCGGCACGGTCCTCGTCACCGGCGGCACGGGCGGGCTCGGCGCGCACGCCGCCCGCTGG
CTCGCCCGGGGCGGCGCCGACCACCTGGTCCTCGTCAGCCGCCGGGGTGCCGACGCCCCC
GGCGCCGACGAACTGGCGGCCGAACTCACCGCCCTGGGCACCGGTGTGACCCTGGCCGCC
TGCGACATCACCGACCGCGAGGCGCTCGCCGCGCTCGTCGACCGGGTCGCCGCCGACGGA
CACCCCGTCCGCGCCGTCCTGCACACCGCCGCGGCCGCCCAGCTGTTCCCCGTACGCGAC
GAGAACCCGGCGAGCATGGCCGCGACCCTGGCCGCCAAGGTCCAGGGCGCCGCCAACCTC
GACGCCGTCCTCGCCGACACCGACCTCGACGCGTTCGTCCTGTACTCCTCCGTCTCCGGG
GTGTGGGGCAGCGCCGACCACGCCGCCTACGCGGCGGGCAACGCCTACCTCGACGCCCTC
GCCGCCCACCGACGCGGCCGGGGCCTCGCCGCCACCTCCGTCGTCTGGGGCATCTGGAGC
GCCGAGGGCGGCGGCCTCGCCACCAGCGACCTCGAACGCGCCCTCCTCGAACGCGGCATC
CCCTTCATGGACCCGCGGCTGGCCGTCGGCGGGCTCCAGCGCGTCCTGGACGACGACGAG
ACCGTCGTCGTGGTCGCCGACGTCGACTGGGCCCGCTTCGTGCCCGTCTTCACCTCCGTA
CGGCCCAGCCCCCTCATCGCCGACCTCCCCGACGTCCGCGCCCTGGCCACCGCCGAGGAC
CGGACCGAACCCGACCCGGGCGACACCGACGGCGCCTCCGCGCTGCGCCGCACCCTCGCG
GGTCTGACCGAACCGGAGGTCCGCCGGACCCTGCTGGAACTCGTCCGCACCAACGCCGCC
GCGGTCCTCGGCCACGAGTCCGCCGACGCCGTCCTGCCCGACCGGGCCTTCCGTGAACTG
GGCTTCGACTCACTGATCGCCGTCGAGCTGCGCAACCGGCTCAACCAGGTCACCGGCCTG
CGGCTGCGCGCAACCGTCGTCTTCGACTACTCCTGCGCCGCGCTCCTCGCCGAGCACCTG
CGCACCGAGCTCCTCGGCGACACCGCCCCGGCCGCGGCCCCGGCGGCCGTCGTCCCCGTC
GCGGACCCCGACGAGCCCATCGCCATCGTCGCGATGAGCTGCCGCTTCCCCGGGGGCATC
GACACCCCGGAGCGGCTGTGGCAACTGCTCGTCGACGGCGGCGAGGTGCTCTCCGGCATG
CCCGCCGACCGCGGCTGGCCCCTGGACCGCCTCTACCACCCCGACCCCGACCACCCGGGC
ACCTCGTACGTCCGCGAGGGCAGCTTCCTGCACGACGCGGGCGACTTCGACCCGGCCTTC
TTCGGTATCTCGCCGCGCGAGGCCGTCGCCATGGACCCGCAGCAGCGGCTGCTCCTGGAG
ACCTCCTGGGAGGCGTTCGAACGGGCGGGCATCGACCCGGCGTCCCTGCGCACCACCCCG
ACCGGTGTCTTCGCCGGCGTCAACTACCAGGACTACACCTCGCTCGCCGGTTCCTCGCCG
GAGGGCGGCGAAGGACATCTGGTCGCGGGCGGAGCCGCCAGCGTGGTCTCCGGGCGCGTC
GCCTACACCCTCGGTCTGGAGGGCCCGGCGGTCACCGTCGACACCGCCTGCTCCTCCTCC
CTGGTCGCGACGCACCTCGCGGCGCAGGCCCTGCGCGGCGGCGACTGCTCGCTCGCCCTC
GCCGGCGGTGTCGCCGTGATGGCCACCCCGGGCGTCTTCGTCGGCTTCTCCCGGCAGCGC
GGCCTCGCCGCCGACGGCCGCTGCAAGGCGTTCGGCGCCTCCGCGGACGGCATGGGCCTC
GCCGAAGGCGTCGGCGTGGTGCTGCTGGAGCGGCTCTCGGACGCCCGCCGCAACGGTCAC
CCGGTGCTCGCCGTGCTGCGCGGCAGCGCCGTCAACCAGGACGGCGCCAGCAACGGCCTG
TCCGCCCCCAACGGCCTCGCCCAGCAGCGGGTCATCCGCCAGGCCCTCACCAACGCCGGG
CTGACCGGGGCCGACGTCGACGTTGTCGAGGCGCACGGCACGGGCACCACCCTCGGCGAC
CCCATCGAGGCGGACGCCCTGCTCGCCACCTACGGGCAGGACCGTCCGCACGGCCGCCCG
CTCTGGCTCGGCGCGCTCAAGTCCAACATCGGCCACACCCAGGCCGCCTCCGGAGTCGCC
GGAATGATCAAGACCGTGCTCTCGCTGCGGCACGGCGTCCTCCCGCGCACCCTGCACGCC
GACGAGCCCTCCCCGCACGTCGACTGGGCCTCCGGCGAGGTGGAACTGCTCACCGAGGCA
CGCGACTGGCCCGACACCGGCGCACCCCGCCGCGCGGGCATCTCCTCCTTCGGCTTCAGC
GGCACCAACGTGCACGCCATCCTCGAACAGGCACCCCCCGCCTCCGACGCGGACGCAGAC
GCAGAAACGGACGCGGACGCCGGCCCGGAGCCGCGGCACGCGCCCACCGCGCCGGTCGTG
CCCTGGGTGCTGTCCGCGAGGTCGCCGCAGGCCCTGACCCACCAGGCCCAGCGGCTGCGC
GGCCACCTCGCCGGAGGCGGCGCCCCCGACCCGCTGGACACCGGCTACTCCCTGGCGACA
GGCCGTACCCCCTTCGAACACCGCGCGGTGCTCCTCGGCACCGGCGGCGACGCCCCGTCG
GCCGCTCTCGACGGGCTGGCCGGCGGCGAGGACACCCCGGGGCTGATCCGCGGCGTGGCC
GACACCGACGGCCGCCGGGTGTTCGTCTTCCCGGGCCAGGGCGCGCAGTGGGCCGGTATG
GCGGTGGAACTGCTGGACACCTCCCCGGTGTTCGCCGCCTCGATGGCCGCCTGCGAGCAG
GCACTGACGCCGTACGTCGACTGGTCGCTCGACGCCGTGCTGCGCGGCGCCCCGGACACG
CCACCCTTCGAACGGGTCGACGTGGTCCAGCCCGCACTGTGGGCCGTGATGGTCTCGCTG
GCCGCGCAGTGGCGCTCCTGGGGCGTCGAGCCCGACGCCGTACTGGGCCACAGCCAGGGC
GAGATCGCCGCCGCCGTGGTCGCCGGGGCCCTCTCCCTGGACGACGGCGCCAAGGTCGTG
GCCCTGCGCAGCCGGGCCATCCTCGCCCTCGCCGGGCACGGCGGCATGGTCTCCGTGGCC
GTCCCGCGCGAGCGCGCCGTCGAACTCGTCGCCCGGTGGTCCGGGCGGCTCTCCCTCGCC
GCCGTCAACGGACCGTCCGCCGTCGTCGTCTCCGGCGACACGGAGGCCCTGACCGAGCTG
ATCGCCGTCTGCGAGGAGGACGGCGTACGGGCCCGCACGATCGCGGTGGACTACGCCTCC
CACTCCGCGCACGTCGAACGCATCCGCGCGGAGGTGCTCGGCGCACTGGACGGCATCACG
CCCGTCGCGGGCCGGGTGCCGCTCTACTCCACCCTCACCGGTGACTGGCTGGACACGACG
GAGATGGACGCCGGGTACTGGTACCGGAACCTGCGCGAGACCGTCGAGTTCGACGGCGCC
GTACGCGCCCTCGCCGACCAGCGCCACCAGGTCTTCGTCGAGGTCTCGCCGCACCCGGTG
CTCACCATGTCCGTGCAGGAGACCATCGAGTCCGCCACAGCCGCCGAGTCCGCCGAGGCC
CCGCGGACCGTGGTGACCGGCACGCTCCGCCGTGACGAGGGCGGCCTCGCCCGCGCGCTC
ACCTCGGCCGCCGAACTGTGGGTGCGCGGCGTCCCGGTGCTGTGGCCGGTCCTCTTCGAA
GGCACCGGAGCCCGCCGCACCGACCTCCCCACCTACCCCTTCGAACACCGGCGCTACTGG
CTCCAGTCCGCCGAGCCGGCCGCCCCGTCGGGCACGGCGGACGAGACGGACGCGGTGGAC
TCCGCGTTCTGGCGGCTCGTCGAGCGCGGTGACGCCGCCGAGGCCGCCGGAGACCTGGCC
GTGGACGCCGAGACGCTCGGCACGGTGCTGCCCGCCCTGAACGCCTGGCGCCGCAGGCAG
CGCGAGGGCGCCGCCGTCGACACCTGGCGCTACCGCGTCGACTGGCAGCCGGTGCCCGAC
CCGCCCGCCGCGTCCCTGTCCGGCACCTGGCTCGTGGTCCTGCCCGAAGGGCACGACGAC
GCACCGGGCGCCCCGCTCGCACGGGACTCCGTGACAGCCCTCACCGAAGCCGGAGCCGAC
GTCGTGACCGTGCGGCTCACCGACGCGGACGCCGACCGTGCCACGCTGGGGGAGCGGCTC
ACCACCGCCCTGGAAGGCCGCACCCCGCAGGGCGTCCTGTCGCTGCTGGCGATCGCCGGA
CGACCGCACCCCGACCATCCCGCCGTCTCCGCCGGTTCGGCCCTCACCCTCGTCCTCGTC
CAGGCGCTCGGCGACCTGGGCGTCGAAGCCCCGCTGTGGTGCGCCACCCACGGCGCCGTC
ACCACCGGCGACACCGACACCCTTAGCGCACCCGACCAGGCACTGATCTGGGGCACCGGC
ATGGTCGCCGCACTGGAGCACCCCACCCGCTGGGGCGGTCTGGTCGACCTGCCGCCGAGC
CTCAACTCCCTGTCCCGCGACCGGCTCCGCGCGATCCTCGCCGGTGCCACCGGTGAGGAC
CAGCTCGCCGTCCGCTCCGTCGGACTGCTCGGCCGACGCCTGGTCCGCGCCCCCCGCCCG
TCCGGCACCCGGCCCGCGTGGAAGCCCCGGGGCACCGTCCTCGTCACCGGCGGCACGGGC
GCCCTCGGCCCCCACGTCGCGCGCTGGCTCGCCCGCGGCGGCGCCGAGCACCTCGTCCTT
CCCGGACGGCGCGGCGCCGACGTCCCCGGAGCCGACGAACTGCGGGCCGAACTCGCCGAA
CTGGGGACCGAGTTGTCCCTGCCCGCGTGCGACGTCGCCGACCGCGACCAGATCGCCGGA
CTCCTCGCCGGACTGGAGGAGCAAGGCACCCCCGTCACCGCCGTGTTCCACGCCGCCGCC
TACATCCAGCTGGCCTCCCTGGACGACACCCCGCTCGACGCCTTCGCCGAGGTCGTCGCC
GCCAAGGCGGAGGGGGCCCGGCACCTGGACGAACTGCTCGACCGCGAGCTCGACGCGTTC
GTGCTGTTCTCCTCCGTCGCAGGTGTCTGGGGCAGCAGCAACCACGCCGCCTACACCGCC
GGCAACGCCTATCTCGACGCCCTCGCCGAACACCGCAGGGCCCGGGGCCTGAGCGCCACC
ACCGTCGACTGGGGCGTCTGGTCGGCCGCCAACCCGTGGGCCGTCCGCGAGACCGTCGAC
GAGTCCGACTTCTACCGGGTGCAGAAGCAGGGCCTGCCGCTCATCGAGCCCGACCTCGCG
CTCGCCGGACTCCAGCAGGCACTCGACGACGACGAGACGGTCATCGCCCTCGCCAACGTC
GACTGGGAACAGTTCGCCGCGGTCTTCGGCTCCGTACGCCCCAGCCGTCTGCTCACCGGC
GTACCGGAGGCCAGGCGGCAACTGGAGGAGGCCGCGACGCCCGGCGCGAGCGCCGCCACA
CCGGCCTCCGACGTGCTGCGCGAGCGCCTGACCGGGCTGGCCGAGGCCGAGCAGCGCCGC
GTCACCCTGGACCTCGTCCGCACCCACGCCGCGGCCGTCCTCGGCCATGACTCGCCGGAG
GAGCTGCGGCCGGGCAGGGCGTTCCAGGAACTCGGCTTCGACTCGCTGACCGCCGTCGAA
CTGCGCAACCGGCTCCGCGCCGCCACCGGCCTCACCCTGCCCGCCACCCTCGTCTTCGAC
TACCCGTCCGCGGCCGTGCTCGCCGACCACATCCGCGCCGAGGTACTCGGCGAGCACCGG
ACGCCCGCCACGCGCGAGCCCGCGCCCGCCGGCACCGCGGCGGCCGACGAGCCGATCGCG
ATCATCGCGATGAGCTGCCGCTTCCCCGGCGGGGTGCACACCCCCGAACAGCTGTGGCGG
CTGCTGGAGGAAGGCGGCGACGTCGTCTCGGAGTTCCCGACCGACCGCGGCTGGCCGCTG
GAGGCCATGTTCGACCCCGACCCGGACCAGCCCGGCACCAGCTATGTGCGGCACGGCGGA
TTCCTCTACGACGCCGGTGAGTTCGACGCCGACTTCTTCGGCATCTCCCCGCGCGAGGCG
GTCGCCATGGACCCGCAGCAGCGACTGCTCCTGGAGACCTCCTGGGAGACCTTCGAACGC
GCCGGTCTCGACCCGGACCGCCTGCGCGGCACCGACACCGGCGTCTTCACCGGCGTCAAC
TACCAGGACTACGGCGCCTCCGTGGCCCAGACCCAGGAGAACGAGGGCCACCTCCTCACC
GGCAGCGCGGCCAGCGTGATCTCCGGCCGGATCTCCTACACCCTCGGTCTGGAGGGCCCC
GCCGTCACCGTCGACACCGCCTGCTCCGCGTCCCTCGTCGCGGTGCACCTGGCCGCCCAG
GCGCTGCGCGCCGGGGACTGCTCACTCGCCCTGGCCGGGGGCGTCGCGGTGATGTCCAGC
CCGGGCGCCATCATCAGCTTCGCCCGCCAGCGCGGCCTCGCCGCCGACGGCCGCTGCAAG
GCGTTCTCCGACGCCGCCGACGGCATGGGCATGGCCGAGGGCGTCGGCGTGATCCTCCTC
GAACGGCTCTCCGAGGCCCAGCGGCACGGGCACCCCGTGCTGGCCGTCCTGCGCGGCAGC
GCCGTCAACCAGGACGGCGCCAGCAACGGCCTGACCGCCCCCAACGGCCCCTCCCAGCAG
CGGGTCATCCGGGCCGCCCTCGCCAACGCCCGGCTCTCGGCGGCCGACATCGACGTCGTC
GAGACCCACGGCACGGGCACCAGGCTCGGCGACCCCATCGAGGCCCAGGCCCTGCTCGCC
ACGTACGGCCAGGAACGCTCCGACGGGCGCCCCCTGCTGATCGGCTCCCTGAAGTCCAAC
ATCGGGCACGCCCAGGCAGCCGCGGGCGTCGCCGGTGTGATCAAGACCGTCCTGGCGCTC
CGGCACGGGCAGGTGCCGCGCACCCTGCACGTCGACCGGCCCTCGACCCAGGTCGACTGG
ACGGCCGGTGCCGTGGACGTGGTCACCGACACGACCCCGTGGCCGGTGACGGGCCGCCCG
CGCCGTGCCGGGATCTCCGCGTTCGGCATGAGCGGCACCAACGTGCACGCGATCGTGGAG
CAGGCTCCCGAGCCGGCCCCCGAGGAGAGCCCGCGGGACACACCCGACGAGGTGCCGGCC
GGGACCGTCGCCTGGCCGCTCTCCGCCAAGTCCCCGGACGCCCTGCGCGGCCAGGCCGAG
CGGCTGACCGCCCACCTGGCCGACACGCCGGGCCTCCCGCCCGCCGACATCGGCCGGGCC
CTGACCACCCGCACGGCGTTCGAACACCGCGCCGTACTGGTCGGCGACGGCACCCGGCTG
CCCGCCGCGCTGACGGCCCTCGCCGACGACGGCACCGCCCCCGACCTGGTACGCGGCGTC
GCCGACACCGTGGGCCGCACGGTCTTCGTCTTCCCCGGCCAGGGGTCCCAATGGGCCGGT
ATGGCACGGGAGTTGCTGGACGAGTCGCCGGTGTTCGCGGCCCGCATGGAGGAGTGCGAA
CGGGCGCTGGCACCCTTCGTCGACTGGTCGCTGCTCGACGCCGTGCGCTCGGGCAGTGCC
TGGGACCGGGTGGACGTCGTCCAGCCCGCGCTGTTCGCGGTGATGGTGTCGCTGGCCGAG
GTCTGGCGGTCGTTCGGTGTCGTACCGGACGCTGTCGTCGGCCACTCCCAGGGCGAGATC
GCCGCCGCTGTCGTGGCGGGCGCGCTGTCCCTGGAGGACGGGGCCCAGGTGGTCGCCCTG
CGCAGCAAGACCCTCGACGCGCTGGCCGGCCGCGGCGGCATGGCCTCGCTGTCCCTGCCC
GCCGACCAGGCACGGGAGGCCCTCGCCCCCTGGGCCGGCGCCCTGTCGGTCGCCGCGCTG
AACGGCCCCGCCACCACCGTGGTCGCGGGCGACGCGGAGGCTCTGGCGGCCCTGCTCGCG
CAGTGCGAGGCCCAAGGCGTACGGGCCCGGCGCATCGACGTCGACTACGCCTCGCACTCC
GAGCACGTCGAGGAGATCCACGGCATCCTCATGGACGCCCTGGCCGGCATCAAGCCGCTG
CCGAGCGAGGTCCCGCTGTACTCCACGGTGGACGGCGGCTGGCTCGACACCACCGGCATG
CACGCCGGTTACTGGTACCGCAACCTGCGGCAGACCGTCGGCTTCGACCCCGCCGTCCGC
GTCCTGGCCGCCGAGGGGTTCACCTCCTTCGTCGAGGTCAGCCCGCACCCCGTGCTCACC
ATGGCCATCGAGGAGACCACCGAGACCGCCGGACGCGAGGCCGTCGTCCTCGGCACCCTG
CGCCGCGACGAGGGCGGCCTGCGACGCGTCCTGCTGTCGGCGGCCGAACTGTGGGTGCGC
GGAGGTGCGGTCGACTGGACCGCCGCGTTCCCCGGCGAGAGCACGGCCGAGCTGCCGACG
TACGCCTTCCAGCGTCGCCGCTACTGGATCCAGCCGCCCGCGGCGACGCCCCGCGGGCCC
GGCGCCACCGGTCACCCGCTGCTCGGCACGGCCGTCGAGGTCGCCGACACCGGGGATCTC
GTGCTCAGCGGCAGCCTGTCGACACGCACCCACCCCTGGCTCGCGGACCACGCGGTCTCC
GGCGTGGTCCTGCTGCCCGGCACCGGCTTCGTGGAACTGGCCGTACGCGCCGGCGACGAG
GCGGACTGCCCCCGGGTCGAGGAACTGACCCTCCAGGCACCGCTGGTGTTCGACCGGGAC
GCCGCCGTCCAGATCCAGGTGCGGGTCGGCGCGCCCGACGAGTCCGGGCGGCGCACCCTC
GGCGTGTTCTCCCGGGGCGAGGACGGCGCCGGCACTCCGTGGACCGGGCACGCCACCGGC
GTCCTCGCCCCCGCCGGGTCCACCGACCCGGCGGCCCACCCGTACGGCGCGGCATGGCCG
CCCGCCGGGGCGGAACCCGTGTCCGTCGACGGCCTCTACGAGCGGTTCGCGGACGCCGGC
TACGGATACGGCCCCGCCTTCCACGGCCTGCACGCCGCCTGGCGCCTCGGCCAGGACGTC
TACGTGGAGGTCCGACTGCCGGAGGACCTGCACACCGGGGCCGCCGGCTTCGGTCTGCAC
CCCGCGCTGCTGGACGCGGCCCTGCACGGTCTGTGGCTGGCCGCCCCCGAAGGTGCCGAC
CAGAACGACGAACCCGGCACCGCCAGGCTGCCCTTCTCCTGGGAAGGCGTCCGCCTGCAC
GCCTCCGGCGCGACCGAACTGCGCGTGCGGCTGAGCTACGACGACACCGGTTCGGTGGCG
CTGTCCGCCGCCGACCCGGCCGGCCGGCCGGTCGCCGACGTGGCGGCGCTGGCCATCCGG
CCCATCGCCGTCGACGCCCTGCGCGGCGCCGCGGCACAGGGACGCGACTCGCTGTTCACC
CTGGGCTGGACCGCCCTGCCCGCCACCACCGAGCCGCCCGTCGGCCGGTGGGCCGCCCTC
GGCACCGAGCACCTGCTGCCCGAGACCCACGAGAACCTCGACGCGCTCACCGCCGCCGTG
GACGGGGACGCCGCGGTGCCCGACGTGGTCGTCACGCTCTGCCCGCCCGGCGGGAACAGC
GCGGACGCCGCCCGTACCGCGCTCGCCGCCACCCTGCGTCTGCTGCAGACCTGGCTGGCC
GACGACCGCTGGGCCGACACCCGCCTGGTCCTCGTCACCCGGGGCGGTGTCGCCACCGCA
CGCGGCGAGGACATCGGCGACCTGGCGGCCGCCGCCGTGTGGGGGCTCGTGCGCTCCGCG
CAGTCCGAACACCCCGACCGGTTCGTCCTCGTCGACGCCGAGGACCCGGCCGAGGCGCTC
AAGGCCCTGCCCGCCGCGCTGTCCGCGACGGAACCCCAGCTCGCGGTACGCGACGGACGG
ACCCTCGCACCCCGTCTGACCAGGACCCCGCCCACGGATGCCGAGGCCGTGGCCGGCAAG
CCGTGGGACCCCGAGGGCACGGTGCTCGTCACGGGCGCCTTCGGCGTCCTCGGCGGCCTG
GTCGCCCGTCACCTGGTCACCGAGCACGGGGTACGCCACCTGCTGCTGACCGGGCGGCGC
GGCGCCGACACCCCCGAGGCGACCGCCCTGGTCGACGAACTCACCGCCCTGGGCGCCCGG
GTGGAGACCGCCGCCTGCGACACGGCCGACCGGGACGCCCTGGCCGGACTCCTCGCGGGT
GTCCCCGACACCCACCCGCTCACCGCCGTGGTCCACTCGGCCGGCGTCCTCGACGACGGG
GTCATCGGCTCGCTGACCCCCGAGCGACTCGACCACGTCCTGCGCCCCAAGGCGGACGCC
GCGCTCAACCTGCACGAACTGACCCGCGACCTGCCACTGGCCGCCTTCGTGCTCTTCTCG
TCCGCCTCCGGCACCGTCGGCAGCTCCGGGCAGGGCAACTACGCGGCGGCCAACGCCTTC
CTGGACGCCCTCGCCCAGCACCGTCGCGCCCAGGGCCTGCCCGCACAGTCGATCGCCTGG
GGCATGTGGGCCGAGCGCTCCACCCTGACCGGCACCCTCGACGAGGTCGACCTGCGGCGC
ATCGCCCGGGGCGGCGTGGGGGCACTCACCTCCGACGAGGGACTCGCCCTGTTCGACGCC
GCGCTCGAACGGGACGACGCGGTCCTGGTCCCGGTCCGGCTCGACCTGGCCAGGCTGCGC
TCCAGGGCGGGCACCGGCGCCGTGCCCGCCCTCTTCCGCTCACTGGTGCGCGGCGCCGCC
CGCCGGACGGCGGCCACCGGCGGCGCCGCCGACGCGGCGGACACCCTGCGCGGGCGGCTC
GCCGGCCTGGCCGCCGACGACGCCCGCGCCGTCCTCGCCGACCTGGTGTGCGCGCACGCC
GCCGATGTGCTCGGGCACGCCGGAGCCTCGGCCGTCGACCCCGAACGCGCCTTCCGGCAG
CTCGGCTTCGACTCGCTGACCGCGGTGGAACTGCGCAACCGCCTCAACGCCGCGACCGGA
CTGCGGCTCCCCGCCACCCTGGTGTTCGACTACCCGAGCCCGGCGGCCGTCGCCGGGTAC
TGCGCCGAACGTCTCGCCCCGGCCGGCACCCCGCCGGCCGCGGCGGCGCCGACCCCGGCC
GACGACGAGATCACCCGCGCGCTGTCCACGATCCCGCTGGACAGGCTGCGCGACTCCGGC
CTGCTGGAGGCACTGCTGCGCCTGGCCGGACCGGAGAACCGGGACGGCGGCACACCGGCG
TCGTCCGAACGGACGTCCGGCATCGAGGAGATGGACGTGGACGGCCTCGTACGGCTGGCA
CTGGGGAGCGAGAGTGTCTGA
[10] KS36..405
[10] AT596..922
[10] ethylmalonyl-CoA787..791
[10] KR1242..1422
[10] ACP1531..1601
[11] KS1624..2000
[11] AT2167..2492
[11] methylmalonyl-CoA2358..2362
[11] KR2811..2990
[11] ACP3102..3172
[12] KS3196..3572
[12] AT3728..4042
[12] methylmalonyl-CoA3916..3920
[12] DH4085..4250
[12] KR4566..4746
[12] ACP4852..4922
[10] KS106..1215
[10] AT1786..2766
[10] ethylmalonyl-CoA2359..2373
[10] KR3724..4266
[10] ACP4591..4803
[11] KS4870..6000
[11] AT6499..7476
[11] methylmalonyl-CoA7072..7086
[11] KR8431..8970
[11] ACP9304..9516
[12] KS9586..10716
[12] AT11182..12126
[12] methylmalonyl-CoA11746..11760
[12] DH12253..12750
[12] KR13696..14238
[12] ACP14554..14766

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [590-719]  G3DSA:3.40.366.10 [787-912]  G3DSA:3.40.366.10 [2156-2290]  G3DSA:3.40.366.10 [2358-2481]  G3DSA:3.40.366.10 [3722-3848]  G3DSA:3.40.366.10 [3916-4031]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1559-1574]  PS00012 [3130-3145]  PS00012 [4880-4895]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1524-1641]  1.60000240695997e-25 SSF47336 [3095-3213]  3.39999972437717e-28 SSF47336 [4844-4939]  5.10001002358244e-24 SSF47336
SSF47336   ACP_like
 [1529-1604]  3.90000000000001e-67 G3DSA:1.10.1200.10 [3100-3175]  3.90000000000001e-67 G3DSA:1.10.1200.10 [4852-4926]  3.90000000000001e-67 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1531-1601]  PS50075 [3102-3172]  PS50075 [4852-4922]  PS50075
PS50075   ACP_DOMAIN
 [1535-1600]  1.7e-09 PF00550 [3105-3171]  3e-12 PF00550 [4855-4920]  2.5e-12 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1242-1420]  3.60000000000002e-59 PF08659 [2811-2988]  8.70000000000003e-59 PF08659 [4566-4745]  2.50000000000001e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [36-279]  4.40000000000003e-82 PF00109 [1624-1875]  1.10000000000001e-95 PF00109 [3196-3446]  2.09999999999996e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [287-405]  2.50000000000001e-49 PF02801 [1883-2000]  1.70000000000001e-45 PF02801 [3454-3572]  2.29999999999998e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [596-922]  3.90000000000001e-110 PF00698 [2167-2492]  1.99999999999999e-111 PF00698 [3728-4042]  3.10000000000005e-107 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [2-36]  7.09999884211141e-09 SSF101173
SSF101173   Polyketide_synth_docking
 [5-29]  6.3e-10 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [594-881]  1.3000049540733e-68 SSF52151 [2165-2454]  1.59998835313644e-66 SSF52151 [3726-4027]  2.0000139277205e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [721-786]  4.90001027782405e-17 SSF55048 [2292-2357]  1.60000240695997e-18 SSF55048 [3850-3915]  1e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [35-289]  G3DSA:3.40.47.10 [291-458]  G3DSA:3.40.47.10 [1627-1887]  G3DSA:3.40.47.10 [1888-2053]  G3DSA:3.40.47.10 [3199-3458]  G3DSA:3.40.47.10 [3459-3625]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [28-403]  3.49999466863949e-98 SSF53901 [1617-1999]  1.50000965748778e-100 SSF53901 [3189-3570]  2.1000026783403e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1242-1460]  1.20000000000001e-95 G3DSA:3.40.50.720 [2811-3009]  1.20000000000001e-95 G3DSA:3.40.50.720 [4566-4763]  1.20000000000001e-95 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [192-208]  PS00606 [3359-3375]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [598-903]  5.60004908290974e-125 SM00827 [2169-2473]  5.39997012872478e-125 SM00827 [3730-4024]  2.0000139277205e-118 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1532-1604]  1.20000117458134e-30 SM00823 [3103-3175]  1.20000117458134e-34 SM00823 [4853-4925]  2.99998750445706e-37 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [4085-4250]  2.89997807423187e-85 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [38-457]  SM00825 [1627-2053]  SM00825 [3199-3624]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1242-1422]  7.79998304125571e-52 SM00822 [2811-2990]  6.10002656149838e-48 SM00822 [4566-4746]  3.29999077503323e-63 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit