close all open/close all

CDS information : Conca_00130


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction79,286 / 80,428 / + [in whole cluster]
79,286 / 80,428 / + [in contig]
Location79286..80428 [in whole cluster]
79286..80428 [in contig]
TypeCDS
Length1,143 bp (380 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative glyceroyl-ACP biosynthesis protein
putative 1,3-bisphospho-D-glycerate phosphatase/glyceroyltransferase
Product (GenBank)methoxymalonate biosynthesis protein
Gene
Gene (GenBank)
EC number
Keyword
  • methoxymalonyl-ACP
Note
  • ORF4*
Note (GenBank)
  • ORF7*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q1G727
NITE
Oxzol_00080
PmId
[16895402] The bifunctional glyceryl transferase/phosphatase OzmB belonging to the HAD superfamily that diverts 1,3-bisphosphoglycerate into polyketide biosynthesis. (J Am Chem Soc. , 2006)
ACC
Q8KUG4
NITE
Ansam_00180
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
[17076505] On the biosynthetic origin of methoxymalonyl-acyl carrier protein, the substrate for incorporation of "glycolate" units into ansamitocin and soraphen A. (J Am Chem Soc. , 2006)
PmId
[17390589] Biosynthetic origin of the methoxyl extender unit in bafilomycin and concanamycin using stereospecifically labeled precursors. (J Antibiot (Tokyo). , 2007)

close this sectionSequence

selected fasta
>putative glyceroyl-ACP biosynthesis protein [methoxymalonate biosynthesis protein]
MSDKTGADAPALVKCLVWDLDNTLWQGTLLEDAEVRLPDAIRAAIVELDARGILQSVCSR
NDHDLAWARLEELGVAEYFVLPEIGWGPKSDAVRRIAEGLNFAHRTIAFIDDQPAERAEV
AYHLPDVRCYPAEEASTLTGLPEFSPAVSTVDSRRRREMYQAGFRRETERSAYEGPDEEF
LRSLDLVMRIGRATEEEITRVEELTLRTSQMNATGVHYSDRTLRELSADPGHEVLVTTLA
DRFGPHGAVGVTLVEKHPAVWHLKLLATSCRVVSFGAGSVILNWLVDQAAAAGVHLVADF
RRTDRNRMMEVAYRFAGFDEEPCPCRDAVRTAQGAEEQETAEVERLHLVAAPRSASTTVQ
LIAPDLTERPAADPSVVAPA
selected fasta
>putative glyceroyl-ACP biosynthesis protein [methoxymalonate biosynthesis protein]
ATGAGCGACAAGACCGGCGCCGACGCGCCGGCCCTCGTGAAGTGCCTGGTCTGGGACCTG
GACAACACCCTCTGGCAGGGCACGCTGCTGGAGGACGCGGAGGTACGGCTGCCCGACGCG
ATACGGGCGGCGATCGTCGAACTCGACGCGCGCGGCATCCTGCAGTCCGTCTGCAGCCGC
AACGACCACGACCTGGCCTGGGCCCGTCTCGAAGAGCTGGGCGTCGCCGAGTACTTCGTC
CTGCCCGAGATCGGCTGGGGACCCAAGTCCGACGCGGTCCGGCGCATCGCCGAAGGACTG
AACTTCGCCCACCGGACCATCGCCTTCATCGACGACCAGCCCGCCGAACGGGCCGAGGTC
GCCTACCATCTCCCGGACGTCCGCTGCTACCCGGCCGAGGAGGCGTCCACCCTCACCGGC
CTGCCCGAGTTCAGCCCCGCCGTGAGCACGGTGGACTCCCGGCGCCGACGCGAGATGTAC
CAGGCCGGCTTCCGCAGGGAGACCGAACGGTCCGCCTACGAGGGCCCCGACGAGGAGTTC
CTCCGCTCCCTCGACCTGGTCATGCGCATCGGGCGGGCCACCGAGGAGGAGATCACCAGG
GTCGAGGAACTCACCCTGCGCACCAGCCAGATGAACGCCACCGGAGTGCACTACTCCGAC
CGGACGCTGCGCGAGCTGTCGGCGGACCCCGGCCACGAGGTCCTGGTCACCACCCTCGCC
GACCGGTTCGGACCGCACGGGGCCGTCGGCGTCACGCTGGTCGAGAAGCACCCCGCCGTA
TGGCATCTGAAGCTGCTCGCCACCTCCTGCCGCGTGGTGTCCTTCGGCGCCGGATCGGTC
ATCCTGAACTGGCTCGTGGACCAGGCCGCCGCGGCCGGGGTCCATCTCGTGGCCGACTTC
CGGCGGACGGACCGCAACCGCATGATGGAGGTCGCCTACCGGTTCGCGGGCTTCGACGAG
GAGCCCTGCCCCTGCCGCGACGCCGTGCGGACCGCGCAGGGAGCGGAAGAGCAGGAGACA
GCGGAGGTCGAGCGGCTGCATCTCGTCGCCGCACCCCGGTCCGCCTCCACGACCGTCCAG
TTGATCGCCCCCGACCTGACGGAGCGACCCGCCGCCGACCCCTCGGTCGTGGCCCCGGCG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010033 HAD-superfamily phosphatase, subfamily IIIC (Domain)
 [14-124]  2.7e-17 TIGR01681
TIGR01681   HAD-SF-IIIC
IPR010037 FkbH domain (Domain)
 [13-321]  1.69999999999998e-111 TIGR01686
TIGR01686   FkbH
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [188-321]  5.3e-06 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
 [188-322]  1.30000067202732e-06 SSF55729
SSF55729   Acyl_CoA_acyltransferase
IPR023214 HAD-like domain (Domain)
 [13-115]  1.2e-08 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
 [10-147]  9.59999914716171e-14 SSF56784
SSF56784   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit