close all open/close all

CDS information : Conca_00140


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction81,946 / 80,966 / - [in whole cluster]
81,946 / 80,966 / - [in contig]
Locationcomplement(80966..81946) [in whole cluster]
complement(80966..81946) [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)putative TDP-glucose 4,6-dehydratase
Gene
Gene (GenBank)
EC number4.2.1.46
Keyword
Note
Note (GenBank)
  • ORF 5*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q194R3
NITE
Mith_00070
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative TDP-glucose 4,6-dehydratase]
MNLLVTGAAGFIGSAYVRMLLAGGTAQRSGVSEVTVLDSLTYAGSLDNLDLGDPRLTFVR
GDICDAPLVDKLMQQADQVVHFAAESHVDRSIASADAFVRTNVTGTQTLLDAALRHGVDR
FVHVSTDEVYGSVESGSRTERDPLDPNSPYAASKAASDLLALSYHRTHGLDVRVTRCSNN
YGPRQFPEKIIPLFLTTLLDGGDVPLYGDGLNRRDWLHVEDHCAAIELVRAGGVAGRVYN
ISGGIELSNRELTARLLAAVGATWARVRQVPDRKGHDRRYAIDCTRLRTELGYRPRHDFE
SGLAETFAWYRDNRDWWEPLKRRQPA
selected fasta
>putative dTDP-glucose 4,6-dehydratase [putative TDP-glucose 4,6-dehydratase]
GTGAATCTGCTGGTCACCGGCGCCGCCGGCTTCATCGGCTCCGCTTATGTACGGATGCTG
CTCGCGGGCGGCACCGCACAGCGCAGCGGCGTGTCCGAGGTCACGGTGCTGGACAGCCTG
ACCTACGCCGGGAGCCTGGACAATCTCGATCTCGGCGATCCCCGGCTGACGTTCGTCCGG
GGCGACATCTGCGACGCCCCCCTCGTCGACAAGCTGATGCAACAGGCCGACCAGGTGGTG
CACTTCGCCGCCGAGTCCCATGTGGACCGCTCGATCGCCTCCGCCGACGCTTTCGTGCGC
ACCAACGTCACGGGCACCCAGACCCTGCTGGACGCCGCGCTGCGACACGGCGTCGACCGC
TTCGTGCACGTGTCCACGGACGAGGTCTACGGCTCGGTGGAGAGCGGCTCCCGCACCGAG
CGGGACCCCCTCGACCCCAACTCCCCCTACGCCGCCTCCAAGGCGGCCTCGGACCTTCTG
GCCCTGTCGTACCACCGCACCCACGGCCTCGACGTGCGGGTCACCCGGTGCAGCAACAAC
TACGGGCCGCGGCAGTTCCCCGAGAAGATCATCCCGCTGTTCCTCACGACGCTGCTCGAC
GGTGGTGACGTCCCGCTGTACGGCGACGGGCTCAACCGGCGCGACTGGCTGCACGTCGAG
GACCACTGCGCGGCCATCGAGCTGGTCCGCGCCGGCGGTGTCGCGGGCCGTGTCTACAAC
ATCAGCGGCGGTATCGAGCTGAGCAACCGGGAACTGACCGCGCGGCTGCTCGCGGCAGTC
GGCGCGACCTGGGCGCGCGTACGGCAGGTACCGGACCGCAAGGGCCACGACAGGCGCTAT
GCGATCGACTGCACCAGGTTGCGGACCGAGTTGGGCTACCGTCCGCGGCACGACTTCGAG
TCCGGGCTGGCCGAGACCTTCGCCTGGTATCGCGACAACCGGGACTGGTGGGAGCCCCTC
AAGCGTCGGCAGCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-241]  2.59999999999995e-65 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [3-320]  1.39999999999997e-121 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-178]  1e-64 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [137-165]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-26]  0.729 Signal
Eukaryota   
 [1-22]  0.762 Signal
Bacteria, Gram-negative   
TMHMM No significant hit