close all open/close all

CDS information : Conca_00150


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction82,851 / 81,943 / - [in whole cluster]
82,851 / 81,943 / - [in contig]
Locationcomplement(81943..82851) [in whole cluster]
complement(81943..82851) [in contig]
TypeCDS
Length909 bp (302 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)TDP glucose synthase
Gene
Gene (GenBank)
EC number2.7.7.24
Keyword
Note
Note (GenBank)
  • ORF 6*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q9AGY4
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)
ACC
P37744
PmId
[11697907] Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase. (J Mol Biol. , 2001)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [TDP glucose synthase]
MKGIILAGGNGTRLQPLTFAGSKQLAPVYDKPMIYYPLSMLMLTGIRDILIITRPADLPA
FQAVLGDGRQLGLSLVYATQDKPRGIADAFLVGENHIRGEQCALVLGDNLFHGANLPAML
RRTALKMGGCVLFGHEVADPERFGVAEINAQGELVSIEEKPLNPRSKLAIPGMYFFDAQV
TDIARDLEPSPRGELEITDLLRVYLKMGTAELVWLGRGVTWLDTGTHESLLEAGTFVRDT
QRRQGTRLGCIEEIAMHMGYIDPDDCQALGASMGNSPYGEYVMERARLCKAGVLLPLPSE
EL
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [TDP glucose synthase]
ATGAAGGGGATCATTCTGGCGGGCGGCAACGGCACCCGCCTCCAGCCCCTCACGTTCGCG
GGTTCCAAACAACTCGCGCCGGTCTACGACAAGCCGATGATCTACTACCCGCTCTCCATG
CTCATGCTGACGGGCATCCGGGACATCCTCATCATCACGCGTCCTGCCGACCTCCCCGCC
TTCCAGGCGGTTCTGGGCGACGGCCGGCAGTTGGGGCTGTCCCTCGTCTACGCCACGCAG
GACAAGCCGCGCGGCATCGCCGACGCCTTCCTCGTGGGGGAGAACCACATCCGGGGCGAG
CAGTGCGCGCTGGTCCTCGGCGACAATCTCTTCCACGGCGCCAACCTGCCCGCCATGCTG
CGGCGTACCGCGCTCAAGATGGGTGGCTGTGTGCTGTTCGGCCACGAGGTGGCCGACCCG
GAGCGGTTCGGAGTCGCCGAGATCAACGCGCAGGGCGAACTCGTCTCCATCGAGGAGAAG
CCCCTCAATCCGCGCTCGAAGCTCGCCATCCCGGGGATGTACTTCTTCGACGCCCAGGTC
ACGGACATCGCCAGAGACCTGGAGCCGTCCCCCCGGGGCGAGCTGGAGATCACCGACCTG
CTGCGTGTCTACCTGAAGATGGGCACCGCCGAACTGGTGTGGCTCGGCAGGGGCGTCACG
TGGCTGGACACCGGCACTCATGAATCCCTGCTCGAAGCGGGCACTTTCGTGAGGGACACG
CAGCGCAGGCAGGGCACCCGCCTCGGCTGCATCGAGGAGATCGCCATGCACATGGGATAC
ATCGACCCGGACGACTGCCAAGCGCTGGGTGCGAGCATGGGCAATTCGCCCTACGGCGAG
TACGTCATGGAGCGGGCGCGCCTGTGCAAGGCGGGCGTGCTGCTTCCGCTTCCTTCGGAG
GAGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-238]  1.09999999999999e-55 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [2-284]  5.59999999999999e-118 TIGR01207
TIGR01207   RmlA
SignalP No significant hit
TMHMM No significant hit