close all open/close all

CDS information : Conca_00160


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction85,547 / 83,535 / - [in whole cluster]
85,547 / 83,535 / - [in contig]
Locationcomplement(83535..85547) [in whole cluster]
complement(83535..85547) [in contig]
TypeCDS
Length2,013 bp (670 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative carbamoyltransferase
Product (GenBank)putative carbamoyltransferase
Gene
Gene (GenBank)
EC number2.1.3.-
Keyword
Note
Note (GenBank)
  • ORF7*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q8KUG9
NITE
Ansam_00230
PmId
[14624546] The post-polyketide synthase modification steps in the biosynthesis of the antitumor agent ansamitocin by Actinosynnema pretiosum. (J Am Chem Soc. , 2003)
[22195559] Dual carbamoylations on the polyketide and glycosyl moiety by asm21 result in extended ansamitocin biosynthesis. (Chem Biol. , 2011)

close this sectionSequence

selected fasta
>putative carbamoyltransferase [putative carbamoyltransferase]
MLVLGLSGNFSARDSDLVPLMPDQLFHDSAACLVRDGEVIAAVEEERFNRIKKTTKFPVN
AIRACLDVAGVTVDQLDGVAYYFPEDFVDTTLNFFYTVHPKVPTVYCRQLIKQWFAEEFN
WDLGDDKLVFTPHHDAHAIAAVARSGIPESLVLVLDGRGEENSGTVYRAGEGRLEKLADY
PVFKSLGMLYLNATQLLGYGFGDEYKVMGLAPYGDPATFRDAVSSLYLLGDKGDYNLLPN
MSVPDLVGPSMLARGITPRRKGEPFTQQHKDFAAATQEALEKIVLHVLTHWAESTGLSRL
CFGGGVAHNSTLNGNILRSGLFREVFVHPASHDAGASEGAAFLAADQLGGAARPVRRSRT
ASSGPALGTEAEVRDRLGAWGAALDFERHEDIVPVAAGLLADGAVLGWAQGRSEFGPRAL
GNRSIIADARPAENQTRINAMVKQRESYRPFAPVVTAEAASDYFDLPATEANYDFMSYVV
PVREERRPQLGAVTHIDGTARVQVVDPVANERFHRLVAAFGERTGTPVLLNTSFNNNAEP
IVQTIDDVVTCFLTTDLDYLVVEDFLVRRRSADPSADLDALVPRLRPVTRLARRLGTGAA
AAGPAWHEISLDYAGAPVTKVSEELFTLLSVVDGVRTVGELAKEAGVVPDEVRAELYEIW
QQRYLTITPA
selected fasta
>putative carbamoyltransferase [putative carbamoyltransferase]
ATGTTGGTGCTCGGGTTGAGCGGAAACTTCTCCGCGCGGGACTCGGATCTCGTCCCCCTC
ATGCCGGACCAGTTGTTCCATGACTCGGCCGCGTGTCTGGTGCGGGACGGCGAGGTGATC
GCCGCCGTCGAGGAGGAACGGTTCAACCGGATCAAGAAGACCACCAAGTTCCCGGTCAAC
GCGATCCGCGCCTGCCTGGATGTGGCGGGGGTGACGGTCGACCAGCTCGACGGCGTGGCG
TACTACTTCCCTGAGGACTTCGTCGACACCACGCTCAACTTCTTCTACACCGTCCACCCG
AAGGTGCCCACGGTGTACTGCCGCCAGCTGATCAAGCAGTGGTTCGCCGAGGAGTTCAAC
TGGGATCTCGGCGACGACAAGCTCGTCTTCACCCCGCACCACGACGCGCACGCGATAGCG
GCGGTGGCCCGGTCCGGGATACCGGAGTCGCTGGTGCTGGTCCTGGACGGCCGCGGCGAG
GAGAACTCCGGCACCGTCTACCGGGCGGGCGAGGGACGGCTGGAGAAGCTGGCCGACTAC
CCGGTCTTCAAATCACTGGGCATGCTCTACCTCAACGCCACCCAGCTGCTCGGCTACGGC
TTCGGCGACGAGTACAAGGTGATGGGCCTGGCACCCTACGGCGACCCGGCGACCTTCCGC
GACGCCGTCAGCTCGCTGTACCTGTTGGGCGACAAGGGCGACTACAACCTGCTGCCGAAC
ATGTCGGTGCCCGACCTGGTCGGCCCGTCGATGCTCGCGAGGGGCATCACGCCGCGCCGC
AAGGGCGAGCCGTTCACCCAGCAGCACAAGGACTTCGCCGCCGCCACCCAGGAGGCGCTG
GAGAAGATCGTGCTGCATGTGCTGACGCACTGGGCCGAGTCGACCGGCCTGTCCCGGCTG
TGTTTCGGCGGCGGCGTGGCCCACAATTCCACCCTGAACGGCAACATCCTGCGCTCCGGG
CTGTTCCGCGAGGTGTTCGTGCACCCGGCGTCGCACGACGCCGGCGCGAGCGAGGGTGCC
GCTTTCCTCGCGGCCGACCAGCTGGGCGGTGCGGCCCGGCCGGTCCGCCGGTCCCGCACC
GCGAGCTCGGGCCCCGCGCTGGGTACCGAGGCGGAGGTCCGCGACCGCCTGGGCGCGTGG
GGTGCGGCGCTCGACTTCGAGCGGCACGAGGACATCGTGCCGGTCGCGGCCGGACTGCTG
GCCGACGGTGCGGTCTTGGGCTGGGCGCAAGGACGTTCGGAGTTCGGCCCGCGGGCGCTG
GGCAACCGGAGCATCATCGCGGACGCCCGGCCGGCGGAGAACCAGACCAGGATCAACGCG
ATGGTGAAGCAGCGGGAGAGCTACCGGCCGTTCGCGCCCGTGGTCACCGCCGAGGCCGCC
TCCGACTACTTCGACCTGCCCGCCACCGAGGCGAACTACGACTTCATGTCCTACGTGGTT
CCCGTCCGCGAGGAGCGCCGGCCGCAACTGGGCGCGGTCACCCACATCGACGGCACCGCG
CGAGTGCAGGTCGTCGACCCGGTCGCGAACGAACGGTTCCACCGGCTCGTCGCGGCCTTC
GGCGAGCGCACCGGGACACCGGTGCTGCTCAACACGTCCTTCAACAACAACGCGGAGCCG
ATCGTGCAGACCATCGACGACGTGGTGACGTGCTTCCTGACCACCGATCTGGACTACCTG
GTGGTCGAGGACTTCCTGGTGCGCCGGCGTTCGGCGGACCCATCGGCCGACCTGGACGCA
CTCGTTCCCCGGTTGCGGCCGGTGACCAGGCTGGCGCGCCGACTCGGCACCGGGGCCGCC
GCAGCCGGTCCCGCCTGGCACGAGATCTCCCTGGACTACGCCGGAGCTCCGGTGACCAAG
GTGTCGGAGGAGCTGTTCACGCTGCTCAGCGTCGTGGACGGCGTGCGCACCGTCGGCGAG
CTGGCGAAGGAGGCCGGCGTCGTCCCCGACGAGGTGCGTGCCGAGCTGTACGAAATCTGG
CAGCAGCGGTACCTGACGATTACCCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003696 Carbamoyltransferase (Family)
 [143-503]  8.80000000000003e-95 PF02543
PF02543   CmcH_NodU
SignalP No significant hit
TMHMM No significant hit