close all open/close all

CDS information : Conca_00170


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction86,774 / 86,031 / - [in whole cluster]
86,774 / 86,031 / - [in contig]
Locationcomplement(86031..86774) [in whole cluster]
complement(86031..86774) [in contig]
TypeCDS
Length744 bp (247 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)4-ketoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF 8*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q9L4S5
NITE
Urd_00250
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [4-ketoreductase]
MLVIGRGFIASHLSTIADRHPHAVVVAAGVSSVRVTDPAEFARERALMVDVTQRCLRENL
TAVVLSTASHAMYGSTDRIVEEREPVSPTSPYGWHKLGLERQVAESGANWLVLRLAHVVG
ARQRPHQLLPAFVEQVRSGTVRLYRDTYRDLVDVRDVVSAVDGLLAAGVHGEVVHVASGT
PVPVTAIAAGVRARMGLPARLEVVDAPPVRTTVSTARLRALLPTAVLPGGAGYLDRLLDR
YVADYAG
selected fasta
>putative NDP-hexose C-4 ketoreductase [4-ketoreductase]
ATGCTCGTCATCGGCCGGGGCTTCATCGCAAGCCACCTCAGCACGATCGCCGACCGGCAC
CCGCACGCCGTGGTGGTGGCTGCCGGTGTGTCCAGCGTACGGGTGACCGATCCGGCGGAG
TTCGCCAGGGAGCGGGCGCTCATGGTCGATGTGACGCAGCGCTGCCTGCGAGAGAACCTG
ACCGCGGTGGTGCTGTCGACCGCGTCGCACGCGATGTACGGCTCGACCGACCGCATCGTG
GAGGAACGGGAACCCGTCTCGCCGACTTCGCCCTACGGCTGGCACAAACTCGGGCTGGAG
CGGCAGGTGGCGGAGTCGGGCGCGAACTGGCTCGTGCTGCGGCTGGCGCACGTCGTCGGC
GCACGACAGCGGCCGCACCAACTGCTGCCCGCGTTCGTCGAGCAGGTGCGTTCGGGAACC
GTCCGACTGTACCGGGACACCTACCGAGATCTGGTCGACGTGCGCGATGTCGTGTCCGCT
GTGGACGGTCTGCTGGCGGCCGGTGTGCACGGCGAGGTGGTGCACGTCGCCTCCGGCACC
CCGGTTCCGGTGACCGCGATCGCCGCCGGGGTGCGGGCTCGGATGGGCCTGCCGGCCCGG
CTCGAGGTCGTCGACGCCCCGCCGGTACGCACGACGGTCTCCACCGCCCGGTTGCGGGCC
CTGCTGCCGACCGCCGTCCTGCCGGGCGGCGCCGGCTACCTCGATCGGCTACTCGACCGG
TACGTGGCCGACTACGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [16-176]  3.90000000000001e-20 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [15-192]  4.6e-20 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit