close all open/close all

CDS information : Conca_00180


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction87,823 / 86,774 / - [in whole cluster]
87,823 / 86,774 / - [in contig]
Locationcomplement(86774..87823) [in whole cluster]
complement(86774..87823) [in contig]
TypeCDS
Length1,050 bp (349 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)3-ketoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF 9*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [3-ketoreductase]
MVQPLAEPAPGADFDPAATVRIGVLGAASIAWRRMLPALTATAGVSVAAIASRDRSRAAA
FTERFGGEPIEGYAALLERADIDAVYVPLPNSLHHEWAAAALAAGKHVLAEKPLTTCAAD
TADLVRLAEVNNLVLRENFTFLHHPVHAVVRNLVTAGRIGEPRHFTSSFCFPPLPAADVR
YRPELGGGALLDVGVYPIRAAQLFFGNEIEVAGAVLHVDPVTGVDVSGSALLATGDVVVT
AEFGFRHSYGSRYRLWGSSAQLLLERAFTPPPTHQPVLRIDEQDHAEEIVTPAADQFARS
AAAFAAEVRARRAGVPNSAAASNADTLCTAELLDAVRASARVVTVSGGH
selected fasta
>putative NDP-hexose C-3 ketoreductase [3-ketoreductase]
ATGGTCCAGCCTCTCGCGGAACCCGCCCCCGGAGCGGACTTCGACCCGGCGGCGACGGTG
CGGATCGGTGTGCTGGGGGCGGCATCCATCGCGTGGCGGCGAATGCTCCCTGCTCTGACC
GCTACGGCCGGGGTGTCGGTCGCGGCCATCGCGAGCCGGGATCGGTCCAGGGCCGCGGCG
TTCACCGAGCGGTTCGGTGGCGAGCCGATCGAAGGGTACGCGGCGCTGTTGGAGCGCGCC
GACATCGACGCCGTCTACGTCCCGCTGCCGAACTCCCTCCATCACGAGTGGGCTGCGGCC
GCGCTCGCGGCCGGAAAGCACGTCCTGGCGGAGAAACCGCTGACGACGTGCGCCGCCGAC
ACCGCTGATCTGGTACGCCTGGCCGAAGTCAACAACCTCGTGCTGCGGGAGAACTTCACG
TTCCTGCACCACCCGGTGCACGCCGTCGTGCGGAACCTGGTGACCGCCGGTCGAATCGGC
GAGCCTCGGCACTTCACCAGCTCGTTCTGTTTCCCGCCGCTTCCCGCCGCCGACGTGCGT
TACCGGCCCGAACTGGGCGGCGGGGCGTTGCTGGACGTCGGTGTGTACCCGATCCGGGCG
GCACAACTGTTCTTCGGCAACGAGATCGAGGTCGCCGGCGCGGTGCTGCACGTGGATCCG
GTCACCGGAGTCGACGTGTCCGGCAGCGCGCTGCTCGCGACCGGCGACGTGGTCGTGACG
GCCGAGTTCGGCTTCCGGCACAGCTACGGTTCCCGCTACCGGCTGTGGGGCTCGTCCGCC
CAGCTGCTGCTGGAGCGCGCGTTCACCCCACCCCCGACCCACCAGCCGGTGCTGCGCATC
GATGAACAGGACCATGCCGAGGAGATCGTGACGCCGGCCGCCGATCAGTTCGCCCGATCG
GCCGCTGCTTTCGCCGCCGAGGTCCGGGCCCGCCGAGCCGGCGTGCCGAACTCGGCAGCG
GCGTCCAACGCCGACACCCTGTGCACCGCCGAACTTCTCGACGCCGTCAGGGCATCCGCT
CGCGTCGTCACCGTGTCCGGAGGACACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [20-135]  6.79999999999998e-25 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [152-255]  2.1e-10 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [17-161]  2.19999999999997e-42 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-43]  0.347 Signal
Bacteria, Gram-positive   
TMHMM No significant hit