close all open/close all

CDS information : Conca_00190


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction89,325 / 87,823 / - [in whole cluster]
89,325 / 87,823 / - [in contig]
Locationcomplement(87823..89325) [in whole cluster]
complement(87823..89325) [in contig]
TypeCDS
Length1,503 bp (500 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)2,3-dehydratase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF 10*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [2,3-dehydratase]
MTASPVTPGGLLRTRDPSAAPRVVRSALSTQGTVTATPDFRSWFAERLAVARTTTVAGID
FADLVGWRFADDTGNLVHDSGKFFTIEGLSVAAAHGPVASWSQPIINQPETGVLGILVKE
FDGVLHCLMQAKMEPGNCNVLQLSPTVQATQSNYTAVHRGRPVPYVDMFLSAPPQSVLAD
VLQSEQGSWFYRKRNRNIVVETTADVEVLPGFCWLSLGQVHALLTEDHLVNMNTRTVLSC
LSFSGPNLVGELGCGASGFRAALVRSIETAWGALHTDGEILSWITDLRSRREVEATPIPL
CEVRGWRRLPDRITHDTGVFFDVRAVAVDGGGREIDSWTQPVIAPHGLGVVAFLVARFSG
VLHVLVGVQVEPGLLDFVELGPTVQCTPDSYEHLPAEARPPFLDDVLAAPADRIRFDTEL
SEEGGRFFHARTRHMIVEVDPVVAHGAGPARHRWMTMAQIVGLLRHSHYVNVQARSLVAC
LHSLVARLDDDSPVAPGGGA
selected fasta
>putative NDP-hexose 2,3-dehydratase [2,3-dehydratase]
ATGACCGCATCCCCGGTCACCCCCGGTGGTCTACTTCGGACCCGCGACCCGTCGGCGGCG
CCGCGTGTCGTCCGGTCGGCACTGTCCACCCAGGGCACCGTGACGGCCACACCGGACTTC
CGGTCCTGGTTCGCCGAACGGCTGGCCGTGGCCAGGACCACCACGGTCGCCGGTATCGAC
TTCGCCGACCTGGTCGGCTGGCGTTTCGCTGACGACACCGGCAACCTGGTGCACGACAGC
GGAAAGTTCTTCACCATCGAGGGCCTGTCGGTGGCCGCCGCTCACGGCCCGGTGGCGAGC
TGGTCGCAGCCGATCATCAATCAGCCGGAGACCGGCGTGCTGGGCATCCTGGTCAAGGAG
TTCGACGGGGTGCTGCACTGCCTGATGCAGGCCAAGATGGAGCCGGGCAACTGCAACGTA
TTGCAACTGTCCCCGACCGTGCAGGCCACGCAGAGCAACTACACCGCGGTACACCGCGGC
CGCCCGGTGCCCTATGTGGACATGTTCCTGTCCGCGCCACCGCAGTCGGTGCTCGCCGAC
GTGCTGCAGTCCGAGCAAGGCTCGTGGTTCTACCGCAAACGCAACCGCAACATCGTCGTG
GAGACCACCGCGGACGTCGAGGTGCTGCCCGGCTTCTGCTGGCTGTCACTGGGCCAGGTG
CACGCGCTGCTCACCGAGGACCACCTGGTCAACATGAACACGCGCACTGTGCTGTCCTGC
CTGTCCTTCTCCGGACCGAACCTCGTGGGCGAGCTGGGCTGTGGCGCGTCCGGGTTCCGG
GCGGCCCTGGTGCGGTCGATCGAAACGGCGTGGGGCGCACTGCACACCGACGGCGAGATC
CTCAGCTGGATCACCGACCTGCGGTCCCGCCGCGAGGTCGAGGCCACCCCGATCCCGCTG
TGCGAGGTGCGCGGCTGGCGCCGGCTGCCCGACCGGATCACTCACGACACGGGCGTCTTC
TTCGACGTCCGCGCGGTCGCGGTGGACGGCGGGGGCCGCGAGATCGACAGCTGGACGCAG
CCGGTCATCGCCCCGCACGGGCTCGGTGTCGTGGCGTTCCTCGTCGCCCGGTTCTCCGGG
GTGTTGCACGTACTGGTCGGCGTCCAGGTGGAGCCGGGGCTCCTGGACTTCGTCGAGCTG
GGGCCGACGGTGCAGTGCACGCCGGACAGCTACGAGCACCTGCCGGCCGAGGCCAGGCCG
CCCTTCCTGGACGACGTGCTGGCCGCGCCGGCCGACCGGATCCGGTTCGACACCGAACTC
TCCGAGGAGGGCGGCCGGTTCTTCCACGCCCGTACCCGGCACATGATCGTCGAGGTCGAC
CCGGTGGTGGCGCACGGCGCCGGACCGGCCCGGCACCGGTGGATGACCATGGCCCAGATC
GTCGGGTTGCTACGGCACAGCCACTACGTGAACGTGCAGGCCCGCAGTCTGGTGGCGTGC
CTGCACAGCCTCGTGGCTCGCCTCGATGACGACAGTCCGGTCGCGCCGGGTGGGGGAGCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [37-241]  3.19999999999996e-84 PF03559 [275-481]  1.20000000000001e-77 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit