close all open/close all

CDS information : Conca_00200


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction90,781 / 89,528 / - [in whole cluster]
90,781 / 89,528 / - [in contig]
Locationcomplement(89528..90781) [in whole cluster]
complement(89528..90781) [in contig]
TypeCDS
Length1,254 bp (417 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF 11*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
O70023
PmId
[9651492] Characterization and targeted disruption of a glycosyltransferase gene in the tylosin producer, Streptomyces fradiae. (Gene. , 1998)

close this sectionSequence

selected fasta
>putative glycosyltransferase [glycosyltransferase]
MRIVLLTIGSRGDVQPFVVLGVELKARGHEVVLAAGAEFRSMADRAGLGFRALEALPAGY
ADSVLRDPKVQAALRRGPSMYRMAMAAPRLTGAQQQALIDEMVAAGEGADMVVNTTLTRI
GALGRPDVPWCSVASWPVTETAAWPALGAPELPLGGGYNRFTHRAMGALEWLVYRPSVNR
GRTAAGLPRLGLRSPFRDDGVTRPLLYQFSPHVFAPPADWPEHCHITGYWSDDVRWDNPA
EVTEFVERGDPPLVATFGSAWAVDGPGLLAASVAAAAATGHRLVVVGGPDSPLPAGVEAI
RTESADFVWLLPRAAAVLHHGGQGTTAAVVSAGVPQVVVPCYADQPVWASRMATLGVAPP
PVPFSRLTGDRLAAAVRTAVDDPAIATRVAELAAAVRADRGVAAAADVIEKHAVTWR
selected fasta
>putative glycosyltransferase [glycosyltransferase]
ATGCGGATCGTCCTGCTGACCATTGGTTCGCGCGGTGACGTGCAGCCGTTCGTGGTGCTC
GGCGTTGAGCTGAAGGCTCGCGGGCACGAGGTGGTGCTGGCAGCCGGGGCGGAGTTCAGG
AGCATGGCCGACCGGGCCGGTCTCGGCTTCCGGGCTCTCGAAGCGCTGCCCGCCGGCTAC
GCCGACTCGGTGCTGCGCGATCCGAAGGTGCAGGCCGCCTTGCGGCGTGGGCCGTCGATG
TACCGGATGGCCATGGCGGCGCCACGGCTGACCGGTGCCCAGCAGCAGGCCCTGATCGAC
GAGATGGTGGCCGCCGGCGAGGGCGCGGACATGGTCGTCAACACCACGCTGACCCGGATC
GGCGCGCTGGGCCGGCCGGACGTGCCGTGGTGTTCGGTCGCGTCCTGGCCGGTGACCGAG
ACCGCTGCGTGGCCCGCGCTGGGCGCGCCGGAGCTGCCGCTGGGCGGCGGTTACAACCGG
TTCACCCACCGGGCCATGGGCGCGCTGGAGTGGCTGGTGTACCGGCCCAGCGTGAACCGC
GGCCGGACCGCCGCCGGGCTGCCGCGACTCGGGCTCCGCTCGCCCTTCCGTGACGACGGG
GTCACCCGGCCGCTGCTGTACCAGTTCAGCCCGCACGTGTTCGCGCCGCCCGCAGACTGG
CCGGAGCACTGTCACATCACCGGGTACTGGTCGGACGACGTGCGTTGGGACAATCCGGCG
GAGGTGACCGAGTTCGTCGAACGCGGCGATCCGCCGCTGGTGGCCACCTTCGGCAGCGCC
TGGGCGGTGGACGGTCCCGGCCTGCTCGCGGCGAGCGTGGCGGCAGCGGCGGCAACCGGA
CACCGGCTGGTGGTCGTCGGCGGCCCGGACAGCCCGCTGCCCGCCGGCGTCGAGGCGATC
CGGACCGAAAGCGCCGACTTCGTCTGGCTGCTGCCCCGCGCCGCTGCCGTACTGCACCAC
GGCGGCCAGGGCACCACCGCGGCCGTGGTGTCCGCCGGCGTGCCACAGGTCGTCGTACCT
TGCTATGCGGACCAGCCGGTGTGGGCGAGCCGGATGGCCACGCTGGGCGTCGCACCGCCG
CCGGTGCCGTTCTCCCGGTTGACCGGCGACCGGCTGGCCGCCGCCGTGCGCACCGCCGTC
GACGATCCGGCGATCGCCACTCGGGTGGCGGAGCTGGCGGCGGCGGTGCGCGCGGATCGA
GGCGTGGCCGCCGCCGCGGACGTCATCGAGAAGCACGCCGTCACATGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [312-393]  2.2e-06 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-72]  3.1e-14 PF03033
PF03033   Glyco_transf_28
SignalP
 [1-16]  0.229 Signal
Eukaryota   
TMHMM No significant hit