close all open/close all

CDS information : Conca_00210


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction91,641 / 90,973 / - [in whole cluster]
91,641 / 90,973 / - [in contig]
Locationcomplement(90973..91641) [in whole cluster]
complement(90973..91641) [in contig]
TypeCDS
Length669 bp (222 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative O-methyltransferase
Product (GenBank)methoxymalonate biosynthesis protein
Gene
Gene (GenBank)
EC number2.1.1.-
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
  • ORF 12*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q8KUG5
NITE
Ansam_00190
PmId
[11996558] Functional expression of genes involved in the biosynthesis of the novel polyketide chain extension unit, methoxymalonyl-acyl carrier protein, and engineered biosynthesis of 2-desmethyl-2-methoxy-6-deoxyerythronolide B. (J Am Chem Soc. , 2002)
ACC
P28034
PmId
[1894629] Molecular cloning, induction and taxonomic distribution of caffeoyl-CoA 3-O-methyltransferase, an enzyme involved in disease resistance. (J Biol Chem. , 1991)
[9037150] Structure of the parsley caffeoyl-CoA O-methyltransferase gene, harbouring a novel elicitor responsive cis-acting element. (Plant Mol Biol. , 1997)

close this sectionSequence

selected fasta
>putative O-methyltransferase [methoxymalonate biosynthesis protein]
MAEQIGMTPRLLEYVRQTSLREDDILLELREATAGLPGGVALQVPAEGGQFLALLVRLTR
AAAVLEIGTFTGYSTLCMARALPTHGRLVTCDITDRWPSIGAEFWKRAGVDGLIDLRVGD
AAETLEKLLADEGPGVFDLVFIDADKANYPRYYELSLELLAPGGLVVVDNTLFFGRVTDP
QFTDADTAGIRELNARLRADERVDLSMLTMADGITLARRKDA
selected fasta
>putative O-methyltransferase [methoxymalonate biosynthesis protein]
ATGGCTGAGCAGATCGGCATGACGCCACGGCTTCTCGAGTACGTCAGGCAGACCTCGCTG
CGCGAGGACGACATCCTGCTGGAACTGCGCGAAGCGACCGCCGGGCTGCCCGGCGGCGTC
GCCCTTCAAGTACCCGCGGAGGGGGGCCAGTTCCTCGCGCTGCTGGTCCGGCTCACCCGG
GCGGCCGCGGTCCTGGAGATCGGCACCTTCACCGGCTACAGCACCCTGTGCATGGCCCGC
GCCCTACCGACCCACGGACGACTGGTGACGTGCGACATCACCGATCGCTGGCCGTCGATC
GGCGCGGAGTTCTGGAAGCGGGCCGGGGTGGACGGCCTGATCGACCTCCGGGTGGGCGAC
GCGGCGGAGACCCTGGAGAAGCTGCTCGCCGACGAGGGCCCGGGCGTCTTCGACCTGGTG
TTCATCGACGCGGACAAGGCGAACTACCCGCGGTACTACGAGCTGTCCCTGGAACTGCTC
GCACCCGGCGGCCTCGTCGTCGTGGACAACACGCTTTTCTTCGGCCGGGTCACCGATCCG
CAGTTCACGGACGCCGACACCGCGGGCATCCGTGAACTCAACGCCCGCCTGCGCGCGGAC
GAGCGGGTGGATCTGAGCATGCTCACCATGGCCGACGGCATCACGCTCGCCCGGCGCAAG
GACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002935 O-methyltransferase, family 3 (Family)
 [17-220]  2.50000000000001e-79 PF01596
PF01596   Methyltransf_3
SignalP No significant hit
TMHMM No significant hit