close all open/close all

CDS information : Conca_00230


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction92,914 / 92,102 / - [in whole cluster]
92,914 / 92,102 / - [in contig]
Locationcomplement(92102..92914) [in whole cluster]
complement(92102..92914) [in contig]
TypeCDS
Length813 bp (270 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase
Gene
Gene (GenBank)
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • ORF 14*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q7BUF9
NITE
Rifam_00540
PmId
[19103602] Structure and functional analysis of RifR, the type II thioesterase from the rifamycin biosynthetic pathway. (J Biol Chem. , 2009)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase]
MTYQDEGRTMDRSAEEPDLWLRCFVAAPRARTRLVCFPHAGGSASAYHAMANALPPTAEV
LAVQYPGRQDRRAEKCVDNVPELVDRLVPVLTASADDRPLALFGHSMGATLAYEVARRLE
REGGANSPVTVFLSGRRAPRFERSEYIHQRDDQGILRELELLGGSGAVALADPEILQMVM
PAIRGDYRAAETYVHVPGPPLRCPVVALTGDADPRAAVAEVEAWREYTEGPFTTQVFKGG
HFFLNDHPDAVHSTVRDHLSSLPVFGAGTH
selected fasta
>putative type II thioesterase [thioesterase]
ATGACCTACCAGGACGAAGGACGGACGATGGATCGAAGCGCCGAGGAACCGGACCTGTGG
CTCCGGTGCTTCGTGGCCGCCCCCCGGGCCCGGACACGACTCGTCTGTTTCCCGCACGCC
GGCGGATCGGCGAGTGCCTACCACGCCATGGCGAACGCGCTGCCGCCCACGGCGGAGGTG
CTGGCGGTGCAGTACCCGGGCCGTCAGGACCGGCGGGCCGAGAAGTGCGTCGACAACGTT
CCGGAGCTGGTCGACCGGCTGGTGCCGGTCCTGACCGCATCGGCCGACGACCGGCCGCTG
GCGCTGTTCGGGCACAGCATGGGGGCCACCCTCGCCTACGAGGTGGCGCGCCGACTGGAG
CGGGAGGGCGGGGCGAACAGCCCGGTCACCGTGTTTCTCTCCGGGCGCCGGGCGCCACGT
TTCGAACGCAGTGAGTACATCCACCAGCGCGACGACCAGGGAATTCTGCGGGAGTTGGAG
CTGCTGGGCGGATCCGGCGCCGTGGCGCTGGCCGACCCGGAGATCCTCCAGATGGTCATG
CCGGCCATCCGCGGCGACTATCGCGCGGCGGAGACCTATGTGCATGTGCCGGGACCGCCA
CTGCGCTGCCCGGTGGTGGCGCTGACGGGGGACGCCGACCCGCGGGCGGCCGTGGCGGAG
GTCGAGGCGTGGCGCGAGTACACGGAAGGGCCGTTCACCACGCAGGTGTTCAAGGGCGGC
CACTTCTTTCTCAATGATCATCCGGACGCGGTGCACAGCACGGTCCGCGATCATCTGAGC
TCGCTCCCGGTCTTCGGCGCGGGCACGCATTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [33-258]  1.2e-54 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit