close all open/close all

CDS information : Conca_00240


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction93,058 / 93,915 / + [in whole cluster]
93,058 / 93,915 / + [in contig]
Location93058..93915 [in whole cluster]
93058..93915 [in contig]
TypeCDS
Length858 bp (285 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)phosphoesterase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF 15*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Family/Domain
FD
IPR004843

close this sectionSequence

selected fasta
>putative hydrolase [phosphoesterase]
MRSSGQAPGRLMATSDLHVAYPENRRIVADMRPQSDDDWLIVAGDVGEITEDFTWALTLL
RERFDTVIWAPGNHELWTPPSDPVQLRGEERYRHLVDICRGLGVLTPQDPYPVWDGPGGP
VTVAPLFVLYDYSFRTPTAMTKEQALTQAYEAGVVCTDEMLLHPDPYPSREAWCHARLVE
TERRLAERDPELPTVLVNHFPLVRDPTRVLYHPEFAQWCGTEQTAKWHVRFDAKVVVYGH
LHIPRTTWHDGVRFEEVSVGYPREHRQRGMPRGVLRQILPAVTAS
selected fasta
>putative hydrolase [phosphoesterase]
ATGAGATCTTCCGGACAGGCACCAGGCAGGCTCATGGCGACAAGTGATCTTCACGTGGCC
TATCCGGAGAACCGGCGCATCGTGGCCGACATGCGTCCCCAATCCGACGACGACTGGCTC
ATCGTCGCCGGAGATGTCGGCGAGATTACCGAGGACTTCACGTGGGCGCTGACCCTGCTG
CGAGAACGATTCGACACTGTTATCTGGGCACCGGGGAATCACGAACTCTGGACCCCTCCC
AGCGACCCCGTCCAGTTGCGCGGGGAGGAACGCTACCGCCACCTCGTGGACATCTGCCGC
GGGCTCGGCGTCCTCACCCCGCAGGACCCCTATCCCGTGTGGGACGGACCCGGCGGCCCT
GTCACCGTCGCCCCCCTCTTCGTCCTGTACGACTACAGTTTCCGGACCCCCACCGCCATG
ACCAAGGAGCAAGCGCTCACCCAGGCCTACGAGGCCGGTGTGGTGTGCACCGACGAGATG
CTCCTGCACCCCGACCCCTACCCGAGCCGCGAGGCGTGGTGCCACGCCCGGCTGGTGGAG
ACCGAGCGCCGGCTCGCCGAGCGCGATCCCGAGCTGCCGACCGTACTGGTCAACCACTTT
CCCCTGGTACGGGATCCGACAAGGGTCCTGTACCACCCGGAGTTCGCCCAGTGGTGCGGA
ACCGAACAGACCGCCAAGTGGCATGTGCGGTTCGACGCCAAGGTCGTGGTCTACGGCCAT
CTGCACATCCCCCGCACCACCTGGCACGACGGAGTCCGCTTCGAGGAGGTCTCGGTCGGC
TACCCCCGCGAGCACCGGCAGCGCGGCATGCCCCGAGGCGTCCTGCGCCAGATCCTTCCG
GCGGTGACCGCCTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004843 Metallophosphoesterase domain (Domain)
 [10-244]  2.6e-17 PF00149
PF00149   Metallophos
SignalP No significant hit
TMHMM No significant hit