close all open/close all

CDS information : Conca_00250


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction93,912 / 94,592 / + [in whole cluster]
93,912 / 94,592 / + [in contig]
Location93912..94592 [in whole cluster]
93912..94592 [in contig]
TypeCDS
Length681 bp (226 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative phosphopantetheinyl transferase
Product (GenBank)phosphopantatheinyl transferase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF 16*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
Q6T709
PmId
[14695521] Identification of a phosphopantetheinyl transferase for erythromycin biosynthesis in Saccharopolyspora erythraea. (Chembiochem. , 2004)
ACC
Q58J51
PmId
[15990252] An unexpected role for the putative 4'-phosphopantetheinyl transferase-encoding gene nysF in the regulation of nystatin biosynthesis in Streptomyces noursei ATCC 11455. (FEMS Microbiol Lett. , 2005)

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [phosphopantatheinyl transferase]
MIDQLLPAAVASAWAREDLPGTRLFPEEEAALGDAVDKRRREYTTVRACARRAFTQLGMA
PVPVVPGHRGAPQWPDGLVGSMTHCVGYRAAALARASDALALGIDAEPHQPLPEGVLDVV
ARPEERSWIAGQGNGPGVWWDRLLFGAKEAVFKVWYPLTGRELDFDEAVVDFRPREVTPG
HASGVFDARLLVPGPRMLTELSGRWLVRDGLSVTAIFLPARPPVHG
selected fasta
>putative phosphopantetheinyl transferase [phosphopantatheinyl transferase]
GTGATCGACCAGCTGCTGCCCGCCGCGGTCGCCTCCGCCTGGGCCCGGGAGGACCTCCCC
GGCACCCGCCTCTTCCCCGAGGAGGAAGCGGCACTCGGCGACGCCGTCGACAAACGCCGC
CGCGAGTACACCACCGTACGGGCCTGCGCCCGCAGAGCCTTCACCCAACTCGGCATGGCG
CCGGTCCCGGTCGTCCCCGGCCACCGCGGGGCACCGCAGTGGCCGGACGGTCTGGTCGGA
AGCATGACGCACTGCGTCGGCTACCGTGCCGCCGCCCTCGCCCGGGCCTCCGACGCCCTC
GCCCTGGGGATCGACGCCGAGCCCCACCAGCCCCTGCCGGAGGGGGTCCTCGACGTCGTC
GCCCGGCCCGAGGAACGCTCCTGGATCGCAGGGCAGGGCAACGGTCCCGGAGTGTGGTGG
GACCGGCTGCTGTTCGGCGCCAAGGAAGCCGTCTTCAAGGTCTGGTACCCACTCACGGGC
CGCGAACTGGACTTCGACGAGGCCGTCGTCGATTTCCGTCCCCGGGAAGTCACCCCGGGA
CACGCGTCGGGTGTCTTCGACGCCCGGCTGCTGGTGCCCGGTCCACGCATGCTCACGGAA
CTCTCCGGCCGCTGGCTGGTACGGGACGGCCTGTCCGTCACCGCGATCTTCCTGCCCGCT
CGGCCACCCGTACACGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003542 Enterobactin synthetase-like, component D (Family)
 [37-57]  1.70000295590054e-23 PR01399 [67-85]  1.70000295590054e-23 PR01399 [143-159]  1.70000295590054e-23 PR01399
PR01399   ENTSNTHTASED
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [102-168]  1.9e-13 PF01648
PF01648   ACPS
 [98-220]  6.00000361638163e-12 SSF56214
SSF56214   4-PPT_transf
SignalP
 [1-15]  0.232 Signal
Eukaryota   
TMHMM No significant hit