close all open/close all

CDS information : Conca_00260


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction94,709 / 96,814 / + [in whole cluster]
94,709 / 96,814 / + [in contig]
Location94709..96814 [in whole cluster]
94709..96814 [in contig]
TypeCDS
Length2,106 bp (701 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative regulator
Gene
Gene (GenBank)
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • ORF 17*
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
P25941
PmId
[2253887] Primary structure of AfsR, a global regulatory protein for secondary metabolite formation in Streptomyces coelicolor A3(2). (Gene. , 1990)
[11952895] afsS is a target of AfsR, a transcriptional factor with ATPase activity that globally controls secondary metabolism in Streptomyces coelicolor A3(2). (Mol Microbiol. , 2002)
[17434533] AfsR recruits RNA polymerase to the afsS promoter: a model for transcriptional activation by SARPs. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative regulator]
MEFLLLGPLVIRSGGNELRVPAARQRVILAALVLNANRVVPVDNIASFVWDGTPPPSAVA
TIRTYVMRLRQVLGRAGRARITTRAPGYLIELEEDETDLGRFTAHRKTADTLVQPGRAAE
AAEELRRALALWRHDPLMVIPSRTLQDMEVSHLQRLHLQTRIWCVDLALELQRHAEILPE
LWQMVRGHPLHEGLIGRLMLALFRSGQQPEALDLFQRTRAALIDQLGTEPGSELRAVQRR
ILCAEDEPPRHRAAIEERPEVHGGPGRPWPGWPTPAQLPQGVADFTARGRETAVLGRLLR
GTPPAADPGTTVVINGAAGIGKTALALHAAHSVRGDFADGQVYADLEGSTGNPAQPAEVL
TRLLVGLGVPDVAVPRTMVNRTSLFRSLVADRRMLIVLDDAASTAQVRPLIPGSGGSRVI
VTSRYRLADLEGVHDVTLDALDEEASLQLLERFAGRSRMDAERPAAHRLVEACAGVPLAL
RIVGTRLRSRPRRSLGALAHRLLEQRRLLDELHIGDLSVRAGLDAGYAALRGRSVHGIDL
AAAFRRLGAGNMPYVRGETAAVLLGCSQENAEDVLDVLVDAHLLREHDHSRYHLDALVRA
YARERADAEERPEHQVETLRCLLRWYLHTLVRSVRPGRAGEPEGTYLLRPPTVNWTDDDR
AGLVEALAEAERTGVDLVGRRLVGELRARLPQLVAPRAASG
selected fasta
>putative transcriptional regulator [putative regulator]
ATGGAGTTCTTGTTGTTAGGTCCCCTGGTCATCCGGTCGGGCGGGAACGAGTTGAGAGTG
CCCGCCGCGAGACAGCGGGTGATCCTCGCCGCCCTCGTGCTCAACGCGAACCGAGTGGTC
CCGGTGGACAACATCGCGAGCTTTGTCTGGGACGGCACCCCGCCGCCCAGCGCCGTCGCC
ACGATCCGCACCTATGTCATGAGGTTGCGTCAGGTCCTGGGCAGGGCAGGGAGGGCGAGG
ATCACCACCCGAGCGCCCGGCTATCTGATCGAACTGGAGGAGGACGAGACCGACCTCGGA
CGGTTCACCGCCCACCGGAAGACCGCCGACACCCTCGTCCAGCCGGGCCGCGCCGCGGAA
GCCGCCGAGGAACTTCGCAGGGCGCTCGCCCTGTGGCGGCACGACCCGCTGATGGTCATA
CCCTCGCGCACTCTTCAGGACATGGAGGTCTCTCATCTGCAGCGGCTCCATCTCCAGACC
CGCATCTGGTGCGTGGACCTCGCCCTCGAACTGCAGCGCCATGCCGAGATCCTGCCCGAG
CTGTGGCAGATGGTGCGGGGCCACCCGCTCCACGAGGGGCTCATCGGCCGTCTCATGCTG
GCGCTGTTCCGCTCGGGCCAGCAGCCGGAGGCCCTCGACCTGTTCCAGCGGACCCGCGCC
GCGCTCATCGATCAGCTCGGCACCGAGCCCGGCTCCGAACTACGGGCCGTCCAGCGGCGC
ATCCTGTGCGCCGAGGACGAGCCGCCGCGGCACCGGGCCGCCATCGAGGAGCGCCCCGAG
GTACACGGCGGCCCCGGCCGGCCCTGGCCCGGCTGGCCGACCCCCGCCCAACTGCCGCAG
GGTGTAGCGGACTTCACCGCCCGCGGCCGGGAGACCGCCGTGCTGGGACGGCTGCTGCGC
GGCACGCCGCCCGCCGCGGACCCGGGCACCACGGTCGTGATCAACGGTGCCGCCGGCATC
GGCAAGACCGCGCTGGCACTGCACGCGGCCCACTCCGTCCGCGGTGACTTCGCCGACGGA
CAGGTCTACGCGGACCTGGAGGGCAGCACGGGGAACCCCGCGCAACCCGCCGAGGTCCTC
ACCCGGTTGCTCGTCGGCCTCGGGGTACCCGATGTGGCGGTGCCGAGAACGATGGTCAAC
CGCACCTCCCTCTTCCGGTCCCTGGTCGCCGACCGCCGCATGCTCATCGTGCTCGACGAC
GCCGCGAGCACCGCCCAGGTCCGCCCCCTCATCCCCGGCAGCGGCGGAAGCCGGGTGATC
GTCACCAGCCGCTACCGGCTCGCCGACCTCGAAGGGGTCCACGACGTCACCCTGGACGCG
CTCGACGAGGAAGCCTCGCTGCAACTGCTGGAACGATTCGCCGGCCGTTCCCGCATGGAC
GCCGAACGCCCCGCCGCACACCGGCTCGTCGAAGCGTGCGCCGGTGTGCCGCTGGCCCTG
CGCATCGTCGGCACCCGGCTGCGCTCACGACCCCGCCGCAGCCTCGGAGCCCTGGCCCAC
CGCCTGCTCGAACAGCGGCGCCTGCTCGACGAACTGCACATCGGCGACCTGTCGGTCCGC
GCCGGACTCGACGCGGGATACGCCGCCCTGCGCGGCCGGTCCGTGCACGGCATCGATCTC
GCGGCGGCGTTCCGCAGACTCGGCGCGGGCAACATGCCGTACGTCCGCGGCGAAACCGCG
GCGGTGCTGCTGGGTTGTTCCCAGGAGAACGCCGAGGACGTGCTCGACGTGCTGGTCGAC
GCACACCTGCTGCGCGAGCACGACCACTCCCGCTACCACCTCGACGCCCTGGTGCGCGCG
TACGCCCGTGAACGCGCCGACGCCGAGGAGCGTCCGGAGCACCAGGTGGAGACACTGCGC
TGCCTGCTCCGGTGGTATCTGCACACCCTCGTCCGGAGCGTTCGCCCGGGCCGGGCGGGG
GAGCCGGAAGGCACGTACCTACTGCGCCCGCCGACCGTGAACTGGACGGACGACGACCGC
GCCGGACTCGTCGAGGCCCTCGCCGAGGCGGAGCGGACCGGCGTCGACCTGGTCGGCCGC
CGGCTGGTCGGTGAACTACGGGCACGGCTGCCACAACTCGTGGCGCCCCGGGCCGCGTCC
GGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000767 Disease resistance protein (Family)
 [311-326]  1.20000117458134e-10 PR00364 [388-402]  1.20000117458134e-10 PR00364 [473-487]  1.20000117458134e-10 PR00364
PR00364   DISEASERSIST
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [15-90]  1.29999924468179e-14 SM00862
SM00862   Trans_reg_C
 [23-89]  3.8e-11 PF00486
PF00486   Trans_reg_C
IPR002182 NB-ARC (Domain)
 [294-490]  2.6e-17 PF00931
PF00931   NB-ARC
IPR003593 AAA+ ATPase domain (Domain)
 [308-518]  0.000129999995835436 SM00382
SM00382   AAA
IPR005158 Bacterial transcriptional activator domain (Domain)
 [97-242]  1.40000506907309e-36 SM01043
SM01043   BTAD
 [97-242]  2.8e-35 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [104-217]  0.00042 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [24-92]  2.8e-07 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-91]  2.09999806691534e-16 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-36]  0.339 Signal
Bacteria, Gram-positive   
TMHMM No significant hit