close all open/close all
Conca_00270 Conca_00270   last last

CDS information : Conca_00280


close this sectionLocation

Organism
StrainATCC 27449 (=NBRC 13477)
Entry nameConcanamycin A
Contig
Start / Stop / Direction98,435 / 99,298 / + [in whole cluster]
98,435 / 99,298 / + [in contig]
Location98435..99298 [in whole cluster]
98435..99298 [in contig]
TypeCDS
Length864 bp (287 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 3-hydroxyacyl-CoA dehydrogenase
putative beta-keto-reductase
Product (GenBank)hydroxybutyryl CoA reductase
Gene
Gene (GenBank)
EC number1.1.1.35
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
  • ORF 19*; ethylmalonate biosynthesis
Reference
ACC
PmId
[16207901] Organization of the biosynthetic gene cluster for the macrolide concanamycin A in Streptomyces neyagawaensis ATCC 27449. (Microbiology. , 2005)
Related Reference
ACC
P52041
PmId
[8655474] Cloning, sequencing, and expression of clustered genes encoding beta-hydroxybutyryl-coenzyme A (CoA) dehydrogenase, crotonase, and butyryl-CoA dehydrogenase from Clostridium acetobutylicum ATCC 824. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [hydroxybutyryl CoA reductase]
MNAIQKVAVVGCGVMGSGIAHVCALAGVDVVVAGSSPASLARGRARLTGSLDRALGKGRI
TDRDHENALARVSYTSDLAELADRQLVIESISEDEQAKRDLFARLDQVLQDPETILASNT
SSLSVLRLARATADGGRVFGVHFFNPVPALPLVELVPTLLTREKTAVRAEEFVTDILGKR
VIRSPDRAGFTVNALLIPYLLAAVRMVEAGHASAETVDDAMTLGCSHPMGPLRLADLIGL
DVVTSIAEALHEEFREPQYAPPPLLRRLVEAGMLGRKTGRGLYDYAP
selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [hydroxybutyryl CoA reductase]
ATGAACGCCATCCAGAAGGTCGCAGTCGTGGGCTGCGGCGTCATGGGCTCGGGCATCGCC
CACGTCTGCGCCCTCGCCGGAGTCGACGTCGTGGTCGCGGGGTCCTCGCCCGCATCGCTC
GCCAGGGGCAGGGCACGGCTCACCGGCTCGCTCGACCGGGCGCTGGGCAAGGGCCGGATC
ACCGACCGGGACCACGAGAACGCCCTGGCCCGGGTGTCGTACACCAGTGACCTGGCGGAA
CTGGCCGACCGGCAGCTGGTCATCGAGTCGATCAGCGAGGACGAGCAGGCCAAGCGCGAC
CTGTTCGCCAGGCTGGACCAGGTGCTCCAGGACCCCGAGACCATCCTCGCCTCCAACACC
TCCTCCCTCTCGGTCCTCAGACTCGCCCGGGCCACCGCCGACGGCGGCCGGGTGTTCGGC
GTCCACTTCTTCAACCCGGTGCCCGCACTTCCGCTGGTCGAGCTGGTCCCCACGCTCCTC
ACCCGGGAGAAGACAGCGGTACGGGCCGAGGAATTCGTGACGGACATCCTCGGCAAGCGC
GTCATCCGGTCCCCGGACCGCGCCGGCTTCACGGTCAACGCCCTGCTCATTCCGTACCTC
CTGGCCGCGGTACGCATGGTGGAGGCGGGCCACGCGTCGGCGGAGACGGTGGACGACGCC
ATGACGCTGGGCTGCTCCCACCCGATGGGTCCGCTGCGGCTCGCCGACCTGATCGGGCTC
GACGTGGTCACCTCCATCGCGGAGGCCCTCCACGAGGAGTTCCGCGAGCCCCAGTACGCC
CCGCCACCGCTCCTACGGCGCCTGGTCGAGGCCGGCATGCTGGGCCGCAAGACGGGCAGG
GGCCTCTACGACTACGCCCCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [189-285]  1.1e-32 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [6-186]  1.5e-55 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [189-286]  5.59999989417023e-31 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [191-285]  8.79999999999995e-33 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR016040 NAD(P)-binding domain (Domain)
 [3-190]  1.6e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR022694 3-hydroxyacyl-CoA dehydrogenase (Family)
 [3-287]  6.4999795054176e-44 PIRSF000105
PIRSF000105   HCDH
SignalP
 [1-26]  0.816 Signal
Bacteria, Gram-positive   
 [1-22]  0.947 Signal
Bacteria, Gram-negative   
 [1-20]  0.672 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1   
Conca_00270 Conca_00270   last last