close all open/close all
first first   Cosmo_00020 Cosmo_00020

CDS information : Cosmo_00010


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction365 / 3 / - [in whole cluster]
365 / 3 / - [in contig]
Locationcomplement(3..365) [in whole cluster]
complement(3..365) [in contig]
TypeCDS
Length363 bp (120 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase(fragment)
Product (GenBank)CosM
Gene
Gene (GenBank)cosM
EC number
Keyword
Note
Note (GenBank)
  • putative NDP-hexose 4-ketoreductase
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase(fragment) [CosM]
MSTTTQGGAAVGTVAVLGATGCVGRSVCDELSRTGHRVLAVARHPAPHTRPHAFVPLDVA
GTAPERLAALLDRYGVTAVVNATGGWGTTVEEMRRAHIDLLERLVDGCAATSRRLRVVQL
G
selected fasta
>putative NDP-hexose C-4 ketoreductase(fragment) [CosM]
ATGTCCACCACCACGCAGGGCGGGGCGGCCGTCGGCACCGTGGCCGTGCTCGGCGCCACG
GGGTGCGTCGGCCGCAGCGTCTGTGACGAACTGTCGCGCACCGGGCACCGGGTGCTGGCG
GTGGCCCGGCACCCGGCGCCCCACACCCGCCCGCACGCCTTCGTCCCCCTCGACGTCGCC
GGGACCGCGCCGGAGCGTCTCGCCGCGCTCCTCGACCGGTACGGCGTCACCGCGGTGGTC
AATGCCACCGGCGGCTGGGGCACCACCGTCGAGGAGATGCGCCGGGCCCACATCGACCTC
CTGGAGCGCCTGGTCGACGGCTGTGCCGCGACCTCCCGGCGGCTGCGGGTCGTCCAGCTG
GGG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [12-110]  6.1e-12 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
SignalP
 [1-24]  0.968 Signal
Eukaryota   
TMHMM No significant hit
first first   Cosmo_00020 Cosmo_00020