close all open/close all

CDS information : Cosmo_00020


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction1,000 / 374 / - [in whole cluster]
1,000 / 374 / - [in contig]
Locationcomplement(374..1000) [in whole cluster]
complement(374..1000) [in contig]
TypeCDS
Length627 bp (208 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose epimerase
Product (GenBank)CosL
Gene
Gene (GenBank)cosL
EC number5.1.3.-
Keyword
  • L-rhodosamine
  • L-2-deoxyfucose
  • L-rhodinose
Note
Note (GenBank)
  • putative NDP-hexose 3-5 epimerase
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
O33707
NITE
Adria_00190
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[11129052] Analysis of genes involved in 6-deoxyhexose biosynthesis and transfer in Saccharopolyspora erythraea. (Mol Gen Genet. , 2000)
[15977277] An enzyme module system for the synthesis of dTDP-activated deoxysugars from dTMP and sucrose. (Chembiochem. , 2005)
ACC
Q9S0P2
NITE
Aver_00150
PmId
[11451669] Insights about the biosynthesis of the avermectin deoxysugar L-oleandrose through heterologous expression of Streptomyces avermitilis deoxysugar genes in Streptomyces lividans. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>putative NDP-hexose epimerase [CosL]
MQIRKLKVEGAYEFTPRQFRDHRGLFVSPFQLEAFQQALGRPHFPVAQTNHSISRRGTVR
GIHFTVTPPGTAKYVYCARGRALDIVVDLRVGSPTFMQWDAVEMDQVHFRASYFPVGVGH
AFVALEDDTVMSYLLTGPYVAENELAVDIFDRELGVRLPAGLDTVQSERDAAALSFAAAR
AQGLLPDYAESAAVEERLWQSSGIGASS
selected fasta
>putative NDP-hexose epimerase [CosL]
ATGCAGATCCGTAAGCTCAAGGTCGAGGGTGCCTACGAGTTCACCCCCCGTCAGTTCCGC
GACCACCGCGGGCTGTTCGTCTCGCCCTTCCAGCTGGAGGCGTTCCAGCAGGCGCTGGGG
CGGCCGCACTTCCCGGTCGCGCAGACCAACCACAGCATCTCCCGGCGCGGCACGGTCCGC
GGCATCCACTTCACCGTCACCCCACCAGGTACCGCGAAGTACGTGTACTGCGCGCGCGGC
CGAGCCCTCGACATCGTGGTCGACCTGCGGGTCGGCTCGCCCACCTTCATGCAGTGGGAC
GCGGTCGAGATGGACCAGGTCCACTTCCGTGCCTCGTACTTCCCGGTCGGCGTCGGCCAC
GCCTTCGTCGCGCTGGAGGACGACACCGTCATGTCCTACCTGCTCACGGGCCCGTACGTG
GCCGAGAACGAGCTCGCCGTCGACATCTTCGACCGGGAGCTGGGCGTGCGGCTCCCCGCC
GGTCTCGACACGGTGCAGTCGGAGCGGGACGCCGCGGCGCTGTCCTTCGCCGCGGCCCGG
GCCCAGGGGCTGCTGCCCGACTACGCCGAGTCCGCGGCGGTCGAGGAGCGCCTGTGGCAG
TCCTCCGGCATCGGCGCCTCGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000888 dTDP-4-dehydrorhamnose 3,5-epimerase-related (Family)
 [1-170]  PD001462
PD001462   dTDP_sugar_isom
 [4-177]  1.80000000000002e-53 PF00908
PF00908   dTDP_sugar_isom
IPR011051 RmlC-like cupin domain (Domain)
 [1-202]  1.99999636034521e-61 SSF51182
SSF51182   RmlC_like_cupin
IPR014710 RmlC-like jelly roll fold (Domain)
 [1-190]  2.70000000000002e-55 G3DSA:2.60.120.10
G3DSA:2.60.120.10   RmlC-like_jellyroll
SignalP No significant hit
TMHMM No significant hit