close all open/close all

CDS information : Cosmo_00030


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction2,366 / 1,074 / - [in whole cluster]
2,366 / 1,074 / - [in contig]
Locationcomplement(1074..2366) [in whole cluster]
complement(1074..2366) [in contig]
TypeCDS
Length1,293 bp (430 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductL-2-deoxyfucose glycosyltransferase
Product (GenBank)CosK
Gene
Gene (GenBank)cosk
EC number
Keyword
Note
Note (GenBank)
  • glycosyltransferase
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q9L555
NITE
Acla_00030
PmId
[15078101] AknK is an L-2-deoxyfucosyltransferase in the biosynthesis of the anthracycline aclacinomycin A. (Biochemistry. , 2004)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>L-2-deoxyfucose glycosyltransferase [CosK]
MRVLFTTFAAKSHMHAQVTLAWALKAAGHDVRIASHPDLADEITRTGLTAVGVGEELHLD
EQMQETQENIGQDVDQLESQAQVGLDMSETRPERLTWDYTLGVFTAMTSVVFQNCCSDQM
VDELVEHCRSWKPDLVLWDTMTFAGAIAAMATGTAHGRLLFGMDLAGKMRETFLEQLAAR
PPELRDDPLREWLTWSLERHGASFEEAAVTGDFTVCPLPASMRFPLDLHYVPMRYVPYNG
QSTVPQWLQEPPKRGRRVCITLGVAHREVLGADRASIGDLLEAVAGLDDVEVVATLNENQ
LKDFDTLPDNVRAVDFVPLDALLPTCDAVIHHGGSGSFGTAMIHAVPQLIVVDGVWDTIN
KARYLERRQAGLYVPGKLSAKGLRELLVRLLEEPVFKRNAEALRREALAAPAPAQVVPTL
ERLAAEHRRR
selected fasta
>L-2-deoxyfucose glycosyltransferase [CosK]
ATGCGGGTACTCTTCACCACCTTCGCCGCCAAGTCGCACATGCACGCCCAGGTCACACTC
GCCTGGGCCCTCAAGGCGGCGGGCCACGACGTCAGGATCGCCAGTCACCCCGATCTCGCC
GACGAGATCACCCGTACCGGGCTGACCGCCGTCGGGGTCGGGGAGGAACTGCATCTCGAC
GAGCAGATGCAGGAGACCCAGGAGAACATCGGCCAGGACGTCGACCAGCTGGAGAGCCAG
GCACAGGTCGGTCTCGACATGAGCGAGACCCGCCCGGAGCGGCTCACCTGGGACTACACA
CTCGGTGTGTTCACGGCCATGACCTCGGTCGTCTTCCAGAACTGCTGCTCCGACCAGATG
GTCGACGAGCTGGTGGAGCACTGCCGCTCCTGGAAGCCCGACCTGGTCCTGTGGGACACC
ATGACCTTCGCGGGCGCCATCGCCGCCATGGCCACGGGGACGGCGCACGGCCGGCTGCTC
TTCGGGATGGACCTGGCGGGCAAGATGCGCGAGACCTTCCTGGAGCAGCTGGCGGCGCGT
CCGCCGGAGCTGCGGGACGACCCGCTGCGCGAGTGGCTCACCTGGAGCCTGGAGCGGCAC
GGCGCCTCCTTCGAGGAGGCCGCGGTGACGGGCGACTTCACCGTCTGCCCGCTGCCGGCG
TCCATGCGGTTCCCGCTGGACCTGCACTACGTGCCGATGCGGTACGTGCCGTACAACGGC
CAGTCCACCGTGCCGCAGTGGCTCCAGGAACCGCCGAAGCGGGGCCGCCGGGTGTGCATC
ACGCTGGGTGTGGCGCACCGCGAGGTGCTGGGCGCCGACCGGGCGTCCATCGGCGACCTG
CTGGAGGCCGTCGCGGGGCTCGACGACGTCGAGGTCGTCGCCACGCTCAACGAGAACCAG
CTGAAGGACTTCGACACCCTGCCGGACAACGTGCGGGCCGTCGACTTCGTCCCGCTCGAC
GCGCTGCTGCCCACCTGCGACGCGGTGATCCACCACGGCGGGTCGGGCAGCTTCGGCACG
GCGATGATCCACGCCGTGCCCCAGCTCATCGTCGTCGACGGCGTCTGGGACACCATCAAC
AAGGCCCGCTACCTGGAACGGCGCCAGGCCGGGCTCTACGTGCCCGGCAAGCTCAGCGCG
AAGGGACTGCGCGAGCTGCTCGTCCGCCTGCTCGAGGAACCGGTCTTCAAGCGCAACGCC
GAGGCCCTGCGGCGCGAGGCGCTCGCCGCTCCCGCCCCCGCGCAGGTCGTCCCCACGCTG
GAGCGCCTGGCCGCCGAGCACCGCCGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-117]  1.9e-11 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [217-312]  2.1e-31 PF06722
PF06722   DUF1205
SignalP
 [1-28]  0.85 Signal
Eukaryota   
TMHMM No significant hit