close all open/close all

CDS information : Cosmo_00040


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction2,613 / 3,176 / + [in whole cluster]
2,613 / 3,176 / + [in contig]
Location2613..3176 [in whole cluster]
2613..3176 [in contig]
TypeCDS
Length564 bp (187 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative PadR family transcriptional regulator
Product (GenBank)CosS
Gene
Gene (GenBank)cosS
EC number
Keyword
Note
Note (GenBank)
  • putative PadR-family regulator
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q70J74
NITE
Chro_00240
PmId
[17768249] Involvement of a chromomycin ABC transporter system in secretion of a deacetylated precursor during chromomycin biosynthesis. (Microbiology. , 2007)
Family/Domain
FD
IPR005149

close this sectionSequence

selected fasta
>putative PadR family transcriptional regulator [CosS]
MSATRLLVLGVVRMHGRAHGYLVRSELLSWGADEWAHIKFGSIYHALRQLAKDGLLKSTD
IPDWPGRVDYEIAPPGEEEFFRLLRDALRQGNNRPDMLGAALVLLPALSREEAIALLRER
IASLSAEQGELIAKVDETAGERPQRAHIRELLGLWEHSAASQAAWTEALIERLEAGAYVM
AGEEKGA
selected fasta
>putative PadR family transcriptional regulator [CosS]
ATGTCCGCCACGCGATTGCTCGTCCTGGGGGTCGTGCGGATGCACGGCCGGGCGCACGGC
TATCTGGTCCGCTCCGAGCTGTTGTCCTGGGGTGCCGACGAATGGGCGCACATCAAGTTC
GGCTCGATCTACCACGCGCTCAGGCAGCTGGCCAAGGACGGCCTGCTGAAGTCGACCGAC
ATCCCCGACTGGCCCGGCCGCGTCGACTACGAGATCGCGCCCCCGGGCGAGGAGGAGTTC
TTCCGGCTGCTGCGCGACGCGCTGCGCCAGGGGAACAACCGACCGGACATGCTGGGGGCG
GCGCTCGTCCTGCTGCCGGCGCTCAGCCGCGAGGAGGCGATCGCCCTGTTGCGGGAGCGC
ATCGCGTCGCTCTCGGCGGAGCAGGGTGAGCTGATCGCGAAGGTCGACGAGACGGCGGGC
GAGCGGCCGCAGCGGGCCCACATCCGCGAACTCCTCGGCCTCTGGGAGCACAGCGCCGCG
AGCCAGGCCGCCTGGACCGAGGCACTGATCGAGCGCCTGGAGGCGGGCGCCTACGTCATG
GCGGGGGAGGAGAAGGGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005149 Transcription regulator PadR N-terminal (Domain)
 [8-80]  5.2e-06 PF03551
PF03551   PadR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [4-85]  6.00000000000001e-11 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-20]  0.429 Signal
Bacteria, Gram-negative   
 [1-20]  0.887 Signal
Eukaryota   
TMHMM No significant hit