close all open/close all

CDS information : Cosmo_00050


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction3,284 / 4,261 / + [in whole cluster]
3,284 / 4,261 / + [in contig]
Location3284..4261 [in whole cluster]
3284..4261 [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)CosY
Gene
Gene (GenBank)cosY
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [CosY]
MPIMLTSEDVDDAFDDEAFMEERFSDVQRLLLGRGPALGPETPVLLPATHCRLTVGPHTS
GPFGRCFAVRLDPGADQSAPRVELLLADDGSLLGLVDAGALDGWRSAIPSGLAARYLAPP
APSLLGLFGSGEPAWSCLLVLHHALPSLSEVHVVGRDPAQARDLATAAALRTGLRVRTSE
DARATAAGADVVATTGGHPRVRAEWLAAGALLIDQTATAATAATAAPTAAGPAVGQVGLV
PPRGPAVRQVSLVPPRGPAEDTRHEPLPLAEIVAGRALPRRSGSDIVHYQGAELAGWSAI
AAAAGLGHAWRRDVGTPVRLGRGSP
selected fasta
>hypothetical protein [CosY]
GTGCCGATCATGCTGACCTCCGAAGACGTGGACGACGCCTTCGACGACGAGGCCTTCATG
GAGGAGCGGTTCTCCGACGTCCAGCGACTGCTCCTAGGCCGTGGGCCGGCGCTCGGCCCC
GAGACCCCGGTCCTGCTCCCCGCCACGCACTGCCGGCTGACCGTGGGACCCCACACCTCC
GGCCCCTTCGGCCGCTGCTTCGCCGTCCGCCTCGACCCCGGCGCCGACCAGTCCGCCCCG
CGCGTGGAACTGCTGCTCGCCGACGACGGATCACTCCTCGGCCTGGTCGACGCCGGCGCC
CTGGACGGCTGGCGCAGCGCCATCCCCTCCGGGCTCGCCGCGCGCTACCTCGCCCCGCCG
GCCCCCTCCCTGCTCGGCCTCTTCGGCTCCGGCGAACCGGCCTGGTCCTGCCTGCTCGTG
CTGCACCACGCGCTGCCCTCGCTCTCCGAGGTGCACGTCGTCGGCCGGGACCCGGCCCAG
GCCCGGGACCTCGCGACGGCCGCCGCCCTGCGCACCGGCCTCAGGGTGCGCACGTCCGAG
GACGCCCGCGCCACCGCAGCGGGCGCCGACGTCGTCGCCACCACCGGCGGTCACCCGCGC
GTCCGCGCCGAATGGCTCGCGGCCGGGGCGCTCCTGATCGACCAGACCGCCACGGCCGCC
ACGGCGGCCACGGCCGCGCCGACCGCCGCCGGCCCCGCCGTCGGGCAGGTCGGCCTCGTG
CCCCCGCGCGGTCCCGCCGTACGGCAGGTCAGCCTCGTCCCTCCGCGCGGCCCCGCCGAG
GACACCCGGCACGAACCCCTGCCCCTCGCCGAGATCGTCGCGGGCCGGGCGCTGCCCCGG
CGCAGCGGCTCCGACATCGTCCACTACCAGGGCGCCGAACTGGCCGGCTGGAGCGCCATC
GCCGCCGCCGCAGGACTCGGCCACGCCTGGCGGCGGGACGTCGGCACCCCCGTGCGGCTG
GGGCGCGGCAGTCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003462 Ornithine cyclodeaminase/mu-crystallin (Family)
 [83-215]  2.8e-19 PF02423
PF02423   OCD_Mu_crystall
IPR016040 NAD(P)-binding domain (Domain)
 [125-218]  2.2e-14 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit