close all open/close all

CDS information : Cosmo_00060


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction4,360 / 4,713 / + [in whole cluster]
4,360 / 4,713 / + [in contig]
Location4360..4713 [in whole cluster]
4360..4713 [in contig]
TypeCDS
Length354 bp (117 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative C-12 oxygenase
Product (GenBank)CosX
Gene
Gene (GenBank)cosX
EC number
Keyword
  • anthraquinone
Note
Note (GenBank)
  • putative monooxygenase
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q8VWB4
PmId
[12399480] Expression, purification, and characterization of AknX anthrone oxygenase, which is involved in aklavinone biosynthesis in Streptomyces galilaeus. (J Bacteriol. , 2002)
ACC
O54259
NITE
Nogl_00350
PmId
[19255477] Expression, purification and crystallization of the cofactor-independent monooxygenase SnoaB from the nogalamycin biosynthetic pathway. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2009)
[20052967] Crystal structure of the cofactor-independent monooxygenase SnoaB from Streptomyces nogalater: implications for the reaction mechanism. (Biochemistry. , 2010)

close this sectionSequence

selected fasta
>putative C-12 oxygenase [CosX]
MRSTDPMSADQPGPASGGPATFVNSFTLRTTPEEFEDVFARTARFMERQPGFLGYTLVRH
LEQPHSYVNIARWADVASFRAAVGQSDFRPHAEALRAISTSSSNLYLERRSATGEAR
selected fasta
>putative C-12 oxygenase [CosX]
ATGAGGAGCACCGATCCCATGTCAGCCGATCAGCCCGGCCCCGCCTCCGGCGGCCCGGCC
ACCTTCGTCAACAGCTTCACCCTCCGCACCACCCCGGAGGAGTTCGAGGACGTCTTCGCC
CGCACGGCACGCTTCATGGAGCGCCAGCCCGGCTTCCTCGGCTACACCCTCGTACGCCAC
CTGGAACAGCCGCACAGCTACGTCAACATCGCCCGCTGGGCCGACGTCGCCTCCTTCCGC
GCCGCGGTCGGCCAGAGCGACTTCCGGCCGCACGCCGAGGCGCTGCGGGCGATCAGCACC
AGCAGCTCCAACCTCTACCTGGAGCGGCGCAGCGCCACCGGGGAGGCGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007138 Antibiotic biosynthesis monooxygenase (Domain)
 [21-93]  3.5e-17 PF03992
PF03992   ABM
IPR011008 Dimeric alpha-beta barrel (Domain)
 [19-97]  4.30000170645867e-17 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit