close all open/close all

CDS information : Cosmo_00070


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction4,710 / 5,978 / + [in whole cluster]
4,710 / 5,978 / + [in contig]
Location4710..5978 [in whole cluster]
4710..5978 [in contig]
TypeCDS
Length1,269 bp (422 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)CosB
Gene
Gene (GenBank)cosB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • ketosynthase - alpha subunit
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q9L551
NITE
Acla_00070
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
ACC
Q55223
NITE
Dauno_00160
PmId
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

KS3..374

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [CosB]
MTRRVVITGIGVVAPGGIGTKQFWETVTGGRTATRTISLFDPAPFRSRIAAECDFDAAEQ
GLSPEDAERLDRAAQFALVALREAVTDSGLEPDPDTAHRTGVSLGSAVGCTQKLEEEYVA
LSGGGQEWLVDHTAAGAHLYDHFVPSSMAAELAWEAGAEGPCTVVSAGCTSGLDSVGHAA
ALIREGTADVMIAGATDAPISPITVACFDAIRATSPRNDDPATALRPFDRTRNGFVLGEG
AAVLVLEELTAARRRGAHVYAEIAGYASRGNAYHMTGLRTDGRELAAAVDAALDEARLAP
EALGYVNAHGTATKQNDVHETAALKRSLGSHAHRVPVSSIKSMIGHSLGAIGSIEVAATA
LALEHGVIPPTANLTDPDPDLDLDYVPLHARERTMSAALTVGSGFGGFQSAVVLRRPEGR
AA
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [CosB]
ATGACCCGGCGGGTCGTGATCACCGGCATCGGGGTGGTGGCCCCCGGCGGCATCGGCACC
AAGCAGTTCTGGGAGACCGTCACCGGCGGCCGCACCGCGACCCGGACCATCAGCCTGTTC
GACCCCGCCCCGTTCCGCTCCCGGATCGCGGCCGAGTGCGACTTCGACGCCGCGGAGCAG
GGCCTGAGCCCCGAGGACGCCGAACGGCTCGACCGGGCGGCGCAGTTCGCCCTGGTCGCG
CTGCGCGAGGCCGTCACCGACAGCGGCTTGGAGCCCGACCCCGACACCGCCCACCGCACC
GGCGTCAGCCTCGGCAGCGCGGTCGGCTGCACCCAGAAACTCGAAGAGGAGTACGTCGCC
CTGAGCGGCGGCGGACAGGAGTGGCTCGTCGACCACACCGCCGCCGGCGCGCACCTCTAC
GACCACTTCGTGCCCAGCTCCATGGCCGCCGAACTCGCCTGGGAGGCCGGCGCCGAAGGC
CCCTGCACCGTCGTCTCCGCCGGCTGCACCTCCGGCCTCGACTCGGTCGGGCACGCGGCC
GCCCTCATCCGCGAGGGCACCGCCGACGTGATGATCGCCGGGGCCACCGACGCCCCCATC
TCCCCGATCACCGTGGCCTGCTTCGACGCCATCCGCGCCACCTCGCCCCGCAACGACGAC
CCGGCGACCGCGCTGCGCCCCTTCGACCGCACCCGCAACGGCTTCGTCCTCGGCGAGGGC
GCCGCCGTCCTGGTCCTGGAGGAGCTGACGGCGGCCCGGCGCCGGGGCGCCCACGTGTAC
GCCGAGATCGCCGGCTACGCCTCCCGGGGCAACGCGTACCACATGACCGGGCTGCGCACC
GACGGACGCGAGCTCGCCGCCGCCGTCGACGCCGCCCTCGACGAGGCCCGGCTCGCCCCC
GAGGCACTCGGGTACGTCAACGCCCACGGCACCGCCACCAAGCAGAACGACGTGCACGAG
ACGGCGGCCCTCAAGCGCAGCCTCGGATCCCACGCCCACCGCGTCCCGGTCAGCTCCATC
AAGTCGATGATCGGGCACTCGCTCGGCGCCATCGGCTCCATCGAGGTCGCCGCCACCGCC
CTGGCCCTCGAACACGGCGTCATCCCGCCCACCGCCAACCTGACCGACCCCGACCCCGAC
CTCGACCTGGACTACGTCCCCCTGCACGCCAGGGAGCGGACCATGTCGGCCGCGCTCACC
GTGGGCAGCGGCTTCGGCGGCTTCCAGAGCGCGGTGGTGCTGCGCCGGCCCGAGGGGCGG
GCCGCATGA
KS3..374
KS7..1122

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-251]  2.19999999999997e-61 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-374]  4.2e-37 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-265]  3.19999999999996e-65 G3DSA:3.40.47.10 [270-418]  2.4e-51 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-257]  2.0000139277205e-67 SSF53901 [219-418]  1e-63 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP
 [1-19]  0.555 Signal
Eukaryota   
TMHMM No significant hit