close all open/close all

CDS information : Cosmo_00080


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction5,975 / 7,219 / + [in whole cluster]
5,975 / 7,219 / + [in contig]
Location5975..7219 [in whole cluster]
5975..7219 [in contig]
TypeCDS
Length1,245 bp (414 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)CosC
Gene
Gene (GenBank)cosC
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
  • ketosynthase - beta subunit
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q9L550
NITE
Acla_00080
PmId
[12137949] Cloning and characterization of Streptomyces galilaeus aclacinomycins polyketide synthase (PKS) cluster. (Gene. , 2002)
ACC
Q55224
NITE
Dauno_00170
PmId
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

CLF2..355

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [CosC]
MTPVVVTGIGVVAPTGIGLDAYWAATLRGDDGIRRVQAFDPSRYPTRRAGEVTGFEAGDH
LPSRLIPQTDRMTQFALAAADWAVADAGIDLDAVPSLERGVVTAGASGGFGFGQRELQHL
WGESPKKVSAYMSFAWFYAVNTGQISIRHGMNGPTGVFVGEQAGGLDALAHARRQIRAGA
RLMISGGMDCSLCPYGMAAQLAGGRLTADAYLPFDDQASGHLPGEGGALLTLESAEGARA
RGRGHYGEIAGFGATFDPRPGSGRPPALRRAVEQALADAQAAPEDIAVVFADGAGVPELD
AAEAAALTEVFGPGGVPVTVPKTATGRLYSGAGPLDVVTALLTLRDGIAPPTVNVSRVPD
TYGLDLVLGRPRPVSGTAALVLARGHHGFNSALVVRAPAPGDAVAHRPEERTAA
selected fasta
>polyketide synthase chain length factor subunit [CosC]
ATGACCCCCGTCGTGGTCACGGGCATCGGCGTCGTCGCCCCCACCGGCATCGGACTCGAC
GCCTACTGGGCGGCGACCCTGCGCGGCGACGACGGCATCCGGCGCGTGCAGGCGTTCGAC
CCCAGCCGCTATCCGACCCGCCGGGCCGGGGAGGTGACCGGGTTCGAGGCGGGCGACCAC
CTGCCGAGCCGGCTGATCCCGCAGACCGACCGCATGACCCAGTTCGCCCTGGCCGCGGCC
GACTGGGCCGTCGCCGACGCCGGCATCGACCTCGACGCGGTGCCGTCGCTGGAACGCGGC
GTCGTCACGGCCGGTGCCTCCGGCGGCTTCGGCTTCGGCCAGCGCGAACTCCAGCACCTG
TGGGGCGAGTCCCCCAAGAAGGTCAGCGCCTACATGTCCTTCGCCTGGTTCTACGCCGTC
AACACCGGCCAGATCTCCATCCGGCACGGCATGAACGGGCCGACCGGCGTCTTCGTCGGC
GAGCAGGCCGGCGGCCTGGACGCCCTCGCCCACGCCCGGCGCCAGATCCGCGCGGGGGCC
CGGCTGATGATCTCCGGCGGCATGGACTGCTCCCTGTGCCCGTACGGCATGGCCGCCCAG
CTGGCCGGCGGACGGCTCACCGCCGACGCCTACCTGCCCTTCGACGACCAGGCCTCCGGT
CATCTGCCCGGCGAGGGCGGGGCGTTGCTCACCCTGGAGAGCGCCGAGGGGGCCCGGGCG
CGCGGACGCGGTCACTACGGCGAGATCGCCGGGTTCGGCGCCACCTTCGACCCGCGCCCC
GGGTCCGGGCGCCCCCCGGCCCTGCGCCGGGCCGTCGAGCAGGCGCTCGCCGACGCCCAA
GCCGCGCCGGAGGACATCGCCGTCGTCTTCGCCGACGGTGCCGGCGTGCCCGAACTCGAC
GCGGCCGAGGCCGCGGCGCTCACCGAGGTCTTCGGCCCGGGAGGAGTCCCGGTCACGGTG
CCCAAGACGGCCACCGGCCGGCTCTACTCCGGTGCCGGGCCGCTCGACGTGGTCACCGCC
CTGCTGACCCTGCGCGACGGGATCGCCCCGCCCACGGTCAACGTCTCGCGGGTGCCCGAC
ACGTACGGCCTCGACCTCGTCCTCGGACGGCCCCGGCCGGTCTCCGGCACGGCGGCCCTG
GTCCTGGCCCGCGGCCACCACGGCTTCAACAGCGCCCTGGTCGTCCGGGCCCCCGCGCCC
GGCGACGCCGTCGCGCACCGGCCCGAGGAGAGGACGGCGGCGTGA
CLF2..355
CLF4..1065

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [2-235]  1.70000000000001e-46 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [246-355]  1.8e-26 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [2-251]  2.19999999999997e-48 G3DSA:3.40.47.10 [263-397]  4.70000000000003e-35 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-243]  1.20000117458134e-57 SSF53901 [206-398]  7.79998304125571e-44 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-18]  0.289 Signal
Eukaryota   
TMHMM No significant hit