close all open/close all

CDS information : Cosmo_00090


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction7,216 / 8,250 / + [in whole cluster]
7,216 / 8,250 / + [in contig]
Location7216..8250 [in whole cluster]
7216..8250 [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)CosE
Gene
Gene (GenBank)cosE
EC number
Keyword
  • propionyl-CoA dependent
  • type II PKS
Note
Note (GenBank)
  • putative ketoacylsynthase for starter unit
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q54816
NITE
Adria_00290
PmId
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
[10423255] Purification and properties of the Streptomyces peucetius DpsC beta-ketoacyl:acyl carrier protein synthase III that specifies the propionate-starter unit for type II polyketide biosynthesis. (Biochemistry. , 1999)
ACC
Q55225
NITE
Dauno_00180
PmId
[11162232] The product of dpsC confers starter unit fidelity upon the daunorubicin polyketide synthase of Streptomyces sp. strain C5. (Metab Eng. , 2001)

close this sectionPKS/NRPS Module

KS108..335

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [CosE]
MNDGALYIRATGTWLPPAERVADAVADGRCEAAVARSTRMESVTVSAGEPAPEMAARAAR
TALERAAAEPGDIDLVLHASFYYQGFDLWAPASYVQRAAVGNQCPAMEIRQVSNGGMAAL
DLAWAYLAADPARVAALLTTGDRFCPPGFDRWRSDPGTVYGDGGTALVVSRHSGFARVRS
IATVSAPDLEGMHRGDDPFGPAPFSHRDVVDLDAHKRDFLARHGVAPTVARVAAAQEAVV
KQALADAGLGLADIDRFVLPHLGHRRLHVAYFAKFGIDPARSTWSWSRTIGHLGAGDPFA
GLDHLATAGELGPGDTCLLFGVGAGFSWSCAVVEILDAPSWRDR
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [CosE]
GTGAACGACGGCGCGTTGTACATCAGGGCCACCGGGACGTGGCTGCCCCCGGCCGAACGG
GTCGCGGACGCGGTCGCGGACGGGCGCTGCGAGGCCGCCGTCGCCCGCTCCACCCGGATG
GAGTCGGTGACGGTCTCCGCGGGCGAGCCCGCCCCCGAGATGGCGGCCCGGGCCGCCCGG
ACCGCGCTGGAGCGGGCCGCCGCCGAACCGGGCGACATCGACCTGGTGCTGCACGCCAGC
TTCTACTACCAGGGCTTCGACCTGTGGGCCCCCGCCTCGTACGTCCAGCGGGCCGCCGTC
GGCAACCAGTGCCCGGCGATGGAGATCCGGCAGGTCTCCAACGGCGGCATGGCGGCACTC
GATCTGGCCTGGGCCTACCTGGCCGCCGACCCGGCCCGGGTGGCGGCCCTGCTGACCACC
GGGGACCGGTTCTGCCCGCCGGGGTTCGACCGGTGGCGCAGCGACCCGGGAACCGTCTAC
GGCGACGGCGGCACCGCCCTCGTGGTGTCGCGGCACTCCGGGTTCGCCCGGGTCCGCAGC
ATCGCGACCGTGTCCGCACCCGACCTGGAGGGCATGCACCGCGGCGACGACCCGTTCGGG
CCCGCCCCGTTCAGTCACCGCGACGTCGTCGACCTCGACGCGCACAAGCGGGACTTCCTG
GCCCGCCACGGCGTGGCGCCGACCGTGGCCCGGGTCGCCGCGGCGCAGGAGGCCGTCGTC
AAGCAGGCGCTCGCCGACGCCGGGCTGGGCCTCGCGGACATCGACCGGTTCGTCCTGCCG
CACCTGGGTCACCGCCGCCTGCACGTCGCGTACTTCGCGAAGTTCGGCATCGACCCCGCG
CGCAGCACCTGGTCCTGGAGTCGGACGATCGGGCACCTGGGCGCCGGAGACCCCTTCGCC
GGGCTCGACCACCTGGCCACCGCCGGGGAGCTCGGCCCGGGTGACACGTGCCTGCTCTTC
GGCGTCGGCGCCGGCTTCAGCTGGTCCTGCGCCGTGGTCGAGATCCTCGACGCACCTTCC
TGGAGGGACCGATGA
KS108..335
KS322..1005

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [244-335]  1.9e-20 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [108-174]  9.3e-06 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [6-165]  5.00000000000001e-21 G3DSA:3.40.47.10 [166-334]  4.00000000000001e-24 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [5-338]  1.50000306971104e-31 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit