close all open/close all

CDS information : Cosmo_00100


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction8,247 / 9,296 / + [in whole cluster]
8,247 / 9,296 / + [in contig]
Location8247..9296 [in whole cluster]
8247..9296 [in contig]
TypeCDS
Length1,050 bp (349 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative acyl-ACP thioesterase
Product (GenBank)CosF
Gene
Gene (GenBank)cosF
EC number
Keyword
  • type II thioesterase
  • non-acetate starter unit
Note
Note (GenBank)
  • putative acyltransferase for starter unit
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q9F6D9
NITE
R1128_00030
PmId
[15260498] The acyltransferase homologue from the initiation module of the R1128 polyketide synthase is an acyl-ACP thioesterase that edits acetyl primer units. (Biochemistry. , 2004)
ACC
Q9KHK3
NITE
Enter_00120
PmId
[21531566] Policing starter unit selection of the enterocin type II polyketide synthase by the type II thioesterase EncL. (Bioorg Med Chem. , 2011)

close this sectionSequence

selected fasta
>putative acyl-ACP thioesterase [CosF]
MNDVRTAADGRDGGTRPVALLLPGQGAQHPRMAAGLLAAEPVFAEAMDEALTALADAGGP
GGHGTGLREDWLGSRDTALMDHVTRSQPLLFAVDYAIGRLVLGWGVRPVALLGHSIGEVA
AAVLSGVFTLPDAAAMVHDRVARLADAPPGGMVAVAATREEVAPFLTDGVVVGAVNAPRQ
TVLAGLDGPLRTVTAALADAGFVLQRVPASTAFHSPALAPAMRGADERIAALPVGEPRIP
VMSGYTGRFLTPAEAKDPAFWSRQPVAPVLFWPALDALLAQGDPVLVEAGPGQGLSQLAR
RHPAVRSGRSAVVPLLPARPGTAEDDVTAVRAAAAALRERAGVPDARPV
selected fasta
>putative acyl-ACP thioesterase [CosF]
ATGAACGACGTCCGCACGGCAGCGGACGGGCGGGACGGCGGTACGCGCCCGGTCGCCCTG
CTGCTGCCCGGCCAGGGAGCACAGCACCCGCGCATGGCGGCGGGCCTCCTGGCCGCCGAG
CCCGTCTTCGCGGAGGCGATGGACGAGGCCCTGACCGCCCTGGCGGACGCCGGTGGGCCG
GGCGGCCACGGCACCGGCCTGCGCGAGGACTGGCTCGGGTCCCGCGACACCGCGCTGATG
GACCACGTCACGCGCTCCCAGCCCCTGCTCTTCGCGGTGGACTACGCCATCGGGCGGCTC
GTGCTCGGCTGGGGCGTGCGGCCCGTCGCCCTGCTCGGCCACAGCATCGGCGAGGTGGCG
GCCGCGGTCCTCTCCGGCGTCTTCACGCTGCCGGACGCCGCCGCCATGGTGCACGACCGC
GTCGCCCGGCTGGCGGACGCGCCGCCCGGCGGGATGGTCGCCGTCGCCGCCACCCGGGAG
GAGGTGGCGCCCTTCCTCACCGACGGCGTGGTCGTCGGCGCCGTCAACGCCCCGCGGCAG
ACGGTCCTGGCCGGACTCGACGGCCCGCTGCGCACCGTCACGGCGGCACTGGCCGACGCC
GGGTTCGTGCTCCAGCGCGTACCCGCCTCCACGGCGTTCCACAGCCCCGCCCTCGCCCCG
GCGATGCGCGGTGCCGACGAGCGGATCGCCGCCCTGCCCGTCGGCGAGCCCCGGATCCCG
GTCATGTCCGGGTACACGGGCCGGTTCCTGACGCCCGCGGAGGCGAAGGACCCGGCCTTC
TGGAGCAGGCAGCCGGTGGCGCCGGTGCTGTTCTGGCCCGCCCTCGACGCCCTCCTCGCC
CAGGGCGACCCGGTGCTCGTGGAGGCCGGTCCGGGGCAGGGGCTGTCGCAGCTGGCCCGC
CGCCACCCGGCCGTGCGCTCCGGCCGCTCCGCCGTCGTCCCGCTGCTGCCGGCCCGGCCG
GGAACCGCCGAGGACGACGTGACCGCCGTACGCGCCGCCGCCGCGGCGCTACGGGAACGC
GCCGGCGTACCGGACGCGCGGCCCGTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [17-144]  8.39999999999997e-52 G3DSA:3.40.366.10 [208-304]  8.39999999999997e-52 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [22-291]  1.6e-38 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [17-303]  2.99998750445706e-47 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [148-210]  9.59999914716171e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [21-320]  6.89998448199219e-58 SM00827
SM00827   PKS_AT
SignalP
 [1-44]  0.122 Signal
Eukaryota   
TMHMM No significant hit