close all open/close all

CDS information : Cosmo_00110


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction9,440 / 10,690 / + [in whole cluster]
9,440 / 10,690 / + [in contig]
Location9440..10690 [in whole cluster]
9440..10690 [in contig]
TypeCDS
Length1,251 bp (416 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase helper protein
Product (GenBank)CosT
Gene
Gene (GenBank)cosT
EC number
Keyword
  • L-rhodosamine
Note
Note (GenBank)
  • putative L-rhodosamine transfer; similar to DnrQ/AknT/DesVIII cytochrome P450-like proteins
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q9L4U5
NITE
Acla_00220
PmId
[15911373] AknT is an activating protein for the glycosyltransferase AknS in L-aminodeoxysugar transfer to the aglycone of aclacinomycin A. (Chem Biol. , 2005)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative glycosyltransferase helper protein [CosT]
MLTDQTNSELGRHLLTIRGVQFIFGAQGDPFAMILRAGDDDPLDHGARAREQGLHESSIG
AWVTAHRELGARILGDERFSPRHAEEGPQAHPGVDVWDNPLLCHVVPLDDAQLNRDPADY
RALARAAAPLLSAEALAARLPEIEAAYRQALAATGERFDLYRDVAVPAALRVVADVLGLP
EETRQRLPELHAGLATALDAGHCPQQLAAARALFTAVTDLSTELTRLVGSGRATGLAALD
GVSPEDAVAVGTLAVVVGVEVTATAVCNAVRVLLDHREEWERIGREPERAGAAVREALRL
APPLRFESRIAREQAEFDGKTVEEGRRVVVLVDAANRDPEAFADPDAFVPGRADGDRSLT
LLGGSAAPVTEALVRLQTEAAVRVLAELRPGLRTGAEVLHRMRSAVLRGVLRFPVA
selected fasta
>putative glycosyltransferase helper protein [CosT]
ATGCTGACCGATCAGACCAACAGCGAGTTGGGCCGGCATCTGCTGACCATCCGAGGCGTC
CAGTTCATCTTCGGCGCCCAGGGCGACCCCTTCGCCATGATCCTGCGCGCCGGGGACGAC
GACCCCCTCGACCACGGGGCGCGCGCCCGCGAACAGGGCCTGCACGAGAGCAGCATCGGC
GCGTGGGTCACCGCGCACCGCGAGCTCGGCGCCCGGATCCTCGGCGACGAGCGGTTCTCC
CCGCGCCACGCCGAGGAGGGGCCGCAGGCCCACCCGGGTGTCGACGTCTGGGACAACCCC
CTGCTGTGCCACGTCGTCCCCCTCGACGACGCCCAGCTCAACCGCGATCCGGCCGACTAC
CGCGCGCTGGCCCGGGCCGCGGCCCCGCTGCTGTCGGCCGAGGCGCTCGCCGCGCGGCTG
CCGGAGATCGAGGCGGCCTACCGCCAGGCGCTCGCCGCGACCGGCGAACGGTTCGACCTG
TACCGGGACGTCGCCGTCCCGGCCGCGCTGCGCGTGGTGGCCGACGTGCTCGGCCTGCCC
GAGGAGACGCGGCAGCGCCTGCCCGAACTGCACGCGGGTCTCGCCACCGCCCTGGACGCC
GGCCACTGCCCGCAGCAACTGGCGGCCGCCCGGGCGCTGTTCACGGCCGTGACGGACCTC
TCCACCGAGCTGACCCGCCTGGTCGGCAGCGGCCGCGCCACCGGCCTCGCCGCGCTCGAC
GGCGTGTCGCCCGAGGACGCGGTCGCCGTCGGGACGCTCGCCGTCGTGGTGGGCGTCGAG
GTCACCGCGACCGCCGTGTGCAACGCGGTGCGGGTCCTCCTGGACCACCGCGAGGAGTGG
GAGCGGATCGGGCGGGAGCCCGAACGGGCCGGCGCCGCGGTCCGCGAGGCCCTGCGGCTG
GCCCCGCCGCTGCGGTTCGAGAGCCGTATCGCGCGCGAGCAGGCCGAGTTCGACGGCAAG
ACCGTCGAGGAGGGCCGGCGCGTCGTGGTGCTCGTCGACGCGGCCAACCGCGACCCGGAG
GCCTTCGCCGACCCGGACGCCTTCGTCCCCGGCCGCGCCGACGGCGACCGGTCGCTCACC
CTGCTCGGCGGTTCCGCCGCCCCGGTCACCGAGGCGCTGGTCCGCCTCCAGACGGAAGCC
GCGGTGCGCGTCCTCGCCGAGCTGCGGCCCGGCCTGCGCACGGGCGCCGAGGTGCTGCAC
CGCATGCGCTCGGCGGTGCTGCGCGGCGTCCTGCGCTTCCCGGTCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [292-352]  9.9e-10 PF00067
PF00067   p450
 [41-415]  9.29999999999998e-45 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [45-415]  1.70000295590053e-38 SSF48264
SSF48264   Cytochrome_P450
SignalP
 [1-28]  0.199 Signal
Eukaryota   
TMHMM No significant hit