close all open/close all

CDS information : Cosmo_00120


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction10,725 / 12,005 / + [in whole cluster]
10,725 / 12,005 / + [in contig]
Location10725..12005 [in whole cluster]
10725..12005 [in contig]
TypeCDS
Length1,281 bp (426 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-L-rhodosamine glycosyltransferase
Product (GenBank)CosG
Gene
Gene (GenBank)cosG
EC number
Keyword
Note
Note (GenBank)
  • glycosyltransferase
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q9L4U6
NITE
Acla_00210
PmId
[15911373] AknT is an activating protein for the glycosyltransferase AknS in L-aminodeoxysugar transfer to the aglycone of aclacinomycin A. (Chem Biol. , 2005)
[17685523] Characterization of rhodosaminyl transfer by the AknS/AknT glycosylation complex and its use in reconstituting the biosynthetic pathway of aclacinomycin A. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>dTDP-L-rhodosamine glycosyltransferase [CosG]
MRVLLTAFAQDAHLNGIVPLAWALRTAGHEVRVAGQPAAVESITRAGLTAVPVGDDHRMD
AVIPTVGPGMLMHHLDRDYLENRPERLSLDFLRASNAMLTATFYAQINNDSMIDALVDYA
RFWQPDLVLWEPFTFAGAVAAKATGAAHARLLAFPDLFANTHLTLRRRQAELPAELRDDP
LEEWLAYTLDRHGAAFDPDVVTGQWSVDQMPPGVRMELGLPTVPTRYVPYNGPGPAVVPD
WLRRPPERRRVCLTLGLTIRDTEFPNAVDVDDVFASLADLDVEVVATLSEKELAQVSRVP
DNTRVVDHVALLALLPSCSAIVHHGGAGTWATAAAYGVPQVALGWMWDAIYRAQRVEELG
AGLHLHSEGLTVEVLRDKLVRVLDDPSFTEGARRLRLAMLSAPSPNEVVPTLEKLTARHR
SVAAAR
selected fasta
>dTDP-L-rhodosamine glycosyltransferase [CosG]
GTGCGTGTACTGCTGACAGCCTTCGCACAGGACGCCCATCTCAACGGCATCGTTCCGCTC
GCCTGGGCGCTGCGGACCGCCGGGCACGAGGTCCGGGTGGCCGGCCAGCCGGCCGCGGTC
GAGAGCATCACCCGGGCCGGTCTGACGGCCGTGCCGGTGGGCGACGACCACCGGATGGAC
GCCGTCATCCCCACCGTCGGTCCCGGGATGCTCATGCACCACCTGGACCGCGACTACCTG
GAGAACCGCCCGGAGCGGCTGAGCCTCGACTTCCTGCGGGCGTCGAACGCGATGCTGACG
GCGACCTTCTACGCGCAGATCAACAACGACTCGATGATCGACGCGCTCGTCGACTACGCC
CGGTTCTGGCAGCCGGACCTGGTGCTCTGGGAGCCCTTCACCTTCGCCGGCGCCGTCGCC
GCCAAGGCGACCGGGGCCGCCCACGCCCGGCTCCTGGCCTTCCCCGACCTGTTCGCGAAC
ACCCACCTGACGCTGCGCCGGCGGCAGGCGGAACTGCCCGCGGAACTGCGCGACGACCCG
CTGGAGGAGTGGCTGGCGTACACCCTCGACCGGCACGGCGCCGCCTTCGACCCCGACGTG
GTCACGGGGCAGTGGTCGGTCGACCAGATGCCCCCCGGCGTGCGGATGGAGCTGGGGCTG
CCGACGGTGCCCACGCGTTACGTGCCGTACAACGGTCCGGGTCCGGCCGTCGTGCCGGAC
TGGCTGCGCCGGCCGCCGGAGCGCCGCCGGGTCTGCCTCACCCTCGGGCTCACCATCCGG
GACACGGAGTTCCCCAACGCCGTCGACGTCGACGACGTCTTCGCCTCGCTGGCCGACCTG
GACGTCGAGGTGGTGGCGACGCTGAGCGAGAAGGAACTCGCCCAGGTGTCGCGGGTGCCG
GACAACACGCGGGTGGTCGACCACGTGGCCCTGCTGGCCCTGCTGCCCAGTTGCTCGGCG
ATCGTCCACCACGGCGGTGCCGGGACGTGGGCGACCGCCGCCGCGTACGGGGTGCCGCAG
GTGGCGCTCGGCTGGATGTGGGACGCGATCTACCGCGCGCAGCGGGTGGAGGAGCTGGGG
GCGGGGCTGCACCTGCACTCCGAGGGCCTGACCGTCGAGGTCCTGCGCGACAAGCTCGTG
CGGGTGCTCGACGACCCCTCGTTCACGGAAGGCGCCCGACGGCTGCGTCTGGCCATGCTG
TCGGCGCCGAGCCCCAACGAAGTGGTGCCCACACTCGAGAAACTGACGGCGCGTCACCGC
TCGGTGGCCGCGGCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-149]  6.60000000000002e-12 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [207-304]  1.4e-32 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.211 Signal
Bacteria, Gram-positive   
 [1-9]  0.327 Signal
Bacteria, Gram-negative   
 [1-23]  0.322 Signal
Eukaryota   
TMHMM No significant hit