close all open/close all

CDS information : Cosmo_00130


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction12,028 / 13,011 / + [in whole cluster]
12,028 / 13,011 / + [in contig]
Location12028..13011 [in whole cluster]
12028..13011 [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)CosH
Gene
Gene (GenBank)cosH
EC number4.2.1.46
Keyword
  • L-rhodosamine
  • L-2-deoxyfucose
  • L-rhodinose
Note
Note (GenBank)
  • putative NDP-hexose 4,6 dehydratase
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q56173
NITE
Grana_00110
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [CosH]
MNILVTGAAGFIGSHFVRTLLSGGYPGHEDDRVTVLDKLTYAGTLNNLPAHHPRLTFVHG
DICDTTLLDKVFPGHEAVVHFAAESHVDRSVAGAEAFVRTNVLGTQALLEAALRHGIGVF
VQVSTDETYGSIAEGRWTEDEPLLPNSPYAASKASADLIARSYWRTHGLDVRITRCANNY
GPGQHPEKLVPLFVTRLLDGQPVPLYGDGSNLREWLHVDDHCHAVRLVLDRGRPGEVYNV
GGGTHLTNKEMTGRLLALCGRDWDLVRRVADRKGHDFRYAVDDSKIRRELGYAPRWSLED
GLRETVEWYAAHRDHWDAREEGADEGY
selected fasta
>putative dTDP-glucose 4,6-dehydratase [CosH]
GTGAACATCCTGGTGACCGGTGCGGCCGGCTTCATCGGCTCGCACTTCGTCAGAACGCTG
CTGAGCGGCGGGTACCCCGGGCACGAGGACGACCGGGTGACCGTCCTGGACAAGCTCACC
TACGCGGGGACGCTGAACAACCTGCCGGCGCACCACCCGCGGCTGACCTTCGTGCACGGC
GACATCTGCGACACCACCCTGCTGGACAAGGTGTTCCCGGGCCACGAGGCGGTCGTCCAC
TTCGCCGCGGAGTCGCACGTCGACCGCTCGGTGGCGGGCGCCGAGGCCTTCGTCCGCACC
AACGTGCTCGGCACGCAGGCCCTGCTCGAAGCGGCGCTGCGGCACGGGATCGGCGTCTTC
GTCCAGGTCTCCACGGACGAGACGTACGGTTCCATCGCCGAGGGGCGCTGGACGGAGGAC
GAGCCGCTGCTGCCCAACTCGCCCTACGCGGCGTCCAAGGCGTCGGCCGACCTCATCGCC
CGGTCGTACTGGCGCACCCACGGCCTCGACGTGCGCATCACCCGCTGCGCCAACAACTAC
GGCCCCGGCCAGCACCCCGAGAAGCTGGTCCCGCTGTTCGTCACCCGGCTCCTCGACGGG
CAGCCGGTCCCGCTGTACGGGGACGGCTCGAACCTGCGCGAGTGGCTGCACGTGGACGAC
CACTGCCACGCGGTGCGGCTGGTGCTGGACCGGGGCCGGCCGGGGGAGGTCTACAACGTC
GGCGGCGGCACCCACCTGACCAACAAGGAGATGACCGGCCGCCTCCTCGCACTCTGCGGA
CGCGACTGGGACCTCGTGCGGCGGGTGGCGGACCGCAAGGGGCACGACTTCCGGTACGCC
GTGGACGACTCCAAGATCCGCCGCGAACTGGGCTACGCGCCCCGCTGGTCGCTCGAGGAC
GGGCTGCGCGAGACGGTCGAGTGGTACGCCGCCCACCGTGACCACTGGGACGCCCGGGAG
GAAGGCGCCGACGAGGGGTACTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-241]  2.70000000000002e-68 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-317]  5.90000000000008e-122 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-177]  9.80000000000012e-66 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit