close all open/close all
Cosmo_00130 Cosmo_00130   last last

CDS information : Cosmo_00140


close this sectionLocation

Organism
StrainDAUFPE 5622
Entry nameCosmomycin
Contig
Start / Stop / Direction13,087 / 14,076 / + [in whole cluster]
13,087 / 14,076 / + [in contig]
Location13087..14076 [in whole cluster]
13087..14076 [in contig]
TypeCDS
Length990 bp (329 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance ABC transporter ATP-binding protein
Product (GenBank)CosI
Gene
Gene (GenBank)cosI
EC number
Keyword
Note
Note (GenBank)
  • putative ABC transporter (ATP binding subunit)
Reference
ACC
PmId
[16810496] Insights in the glycosylation steps during biosynthesis of the antitumor anthracycline cosmomycin: characterization of two glycosyltransferase genes. (Appl Microbiol Biotechnol. , 2006)
Related Reference
ACC
Q9F5K4
NITE
Avil_00350
PmId
[11181344] An ATP-binding cassette transporter and two rRNA methyltransferases are involved in resistance to avilamycin in the producer organism Streptomyces viridochromogenes Tu57. (Antimicrob Agents Chemother. , 2001)

close this sectionSequence

selected fasta
>putative drug resistance ABC transporter ATP-binding protein [CosI]
MGGADLAIQTEALKKKYGDKEALAGLDLEVPRGVVYGLLGPNGAGKTTAVRILSTLLKYD
EGTARVAGYDVATQSAQVRYSIGLLGQHAAVDEDLSGRQNLVMFGRLYHIGKRNAQARAD
ELLERFGLTEAAGKPAKQYSGGMRRRLDLAASLILAPSVLFLDEPTTGLDPRGRNDVWES
VRGLIAEGRTVLLTTQYLEEADQLADRIALIDNGRVVESGTPDQLKNKIGGDRIDVVLRR
AHDLERATHTIGTLLRSEPETDADNRRISVVVDNRVAALTAVARELDDAGIEAEDIALRR
PTLDEVFLNLTGNGAATSAEQSLKEVAQS
selected fasta
>putative drug resistance ABC transporter ATP-binding protein [CosI]
ATGGGCGGCGCCGACCTGGCGATCCAGACCGAAGCTCTGAAGAAGAAATACGGCGACAAG
GAGGCCCTCGCGGGACTCGACCTGGAGGTACCCCGAGGCGTCGTCTACGGGCTCCTCGGC
CCGAACGGCGCCGGAAAGACCACCGCGGTCCGCATCCTCTCCACCCTGCTGAAGTACGAC
GAGGGAACAGCCCGGGTCGCCGGCTACGACGTCGCCACCCAGTCGGCCCAGGTCCGCTAC
AGCATCGGACTCCTCGGCCAGCACGCCGCAGTGGACGAGGACCTGAGCGGCCGTCAGAAC
CTCGTGATGTTCGGGCGCTTATACCACATCGGTAAACGCAACGCCCAGGCCCGGGCCGAC
GAACTGCTGGAGCGCTTCGGCCTCACCGAGGCCGCCGGCAAGCCGGCCAAGCAGTACTCC
GGCGGTATGCGCCGGCGGCTCGACCTCGCCGCCAGCCTCATCCTGGCCCCGTCCGTGCTG
TTCCTCGACGAGCCCACCACCGGGCTCGACCCGCGGGGCCGCAACGACGTCTGGGAGTCC
GTCCGAGGCCTGATCGCCGAGGGCCGCACGGTCCTGCTGACCACCCAGTACCTGGAGGAG
GCCGACCAGCTCGCCGACCGCATCGCCCTGATCGACAACGGCAGGGTCGTCGAGTCCGGC
ACCCCGGACCAGCTCAAGAACAAGATCGGCGGGGACCGGATCGACGTCGTCCTCCGCCGC
GCCCACGACCTCGAACGCGCCACCCACACGATCGGCACCCTGCTGCGCTCCGAGCCCGAG
ACGGACGCCGACAACCGGCGCATCAGCGTCGTCGTCGACAACCGGGTCGCCGCCCTCACC
GCCGTCGCCCGCGAACTCGACGACGCCGGCATCGAGGCCGAGGACATCGCCCTGCGCAGG
CCCACTCTCGACGAGGTGTTCCTGAACCTGACCGGCAACGGGGCGGCCACGTCCGCCGAG
CAGAGCCTCAAGGAGGTCGCCCAGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [8-238]  PS50893
PS50893   ABC_TRANSPORTER_2
 [47-167]  1.2e-18 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [32-215]  1.39999892049878e-12 SM00382
SM00382   AAA
IPR005894 Daunorubicin resistance ABC transporter ATP-binding subunit (Family)
 [15-312]  3.99999999999998e-107 TIGR01188
TIGR01188   DrrA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [139-153]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit
Cosmo_00130 Cosmo_00130   last last