close all open/close all
first first   Crypto_00020 Crypto_00020

CDS information : Crypto_00010


close this sectionLocation

Organism
StrainATCC 53789
Entry nameCryptophycin 1
Contig
Start / Stop / Direction9,964 / 18,789 / + [in whole cluster]
9,964 / 18,789 / + [in contig]
Location9964..18789 [in whole cluster]
9964..18789 [in contig]
TypeCDS
Length8,826 bp (2,941 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)CrpA
Gene
Gene (GenBank)crpA
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase; A-ACP-KS-AT-DH-CM-KR-ACP
Reference
ACC
PmId
[17240975] Biosynthetic characterization and chemoenzymatic assembly of the cryptophycins. Potent anticancer agents from cyanobionts. (ACS Chem Biol. , 2006)
[17240971] Cryptophycin anticancer drugs revisited. (ACS Chem Biol. , 2006)

close this sectionPKS/NRPS Module

0
1 malonyl-CoA
A61..477
PCP587..654
KS680..1068
AT1232..1552
DH1595..1735
CM2115..2215
KR2538..2717
ACP2819..2889

close this sectionSequence

selected fasta
>polyketide synthase [CrpA]
MITPSHENLGANVQALSNSGYLGMPADAPKSLSEVLQRAVKKHSGRGLTYINLDGSEYNQ
SYQDLLEEAQKILGGLRKLGLKPQDKVIFQLERNQDFIAGFWGCILGGFIPIPVPVPINY
EEGSNSTNKLHHIWQLLEQCLILTDIKSVSKIRPLSKLFQSEQFETIAIDELRECEPDKN
LYVSQPEDLALLMLTSGSTSIPKAVKISHQNLLSMTAGTIVMNGFNRQDVTLNWMPMDHV
GALVFLSIMAVDLGCQQVHIPTEYILQNPLNWLDLITRHQGTISWAPNFAFTLLCDRAEE
ISRKHWNLSSMRFLVNAGEPVIAKTARNFLKLLGQHGLPSTALHPAFGMCETCSGITWSN
SFSLETTSDEDTFVSVGGPIPGASVRIVDENQQVVEEGTIGQLQLQGNSVTIGYYQNEEA
NQEAFTKDGWFNTGDLGFLKGGCLTITGRQKDVIIVNGVNYYSHEIEAVVEELGEVEVSY
TAACAIWNENRSTDRLAIFFNTEKTIDNGLVELIKSIRTHVVKSIGINPNYLIPLEKTTI
PKTSIGKIQRKQLKERFENGEFKEIVAQISTALAELKAQNFVSGNELERDVAEIWQGVLQ
IPEVGIHDNFFELGGHSVMLAQVHSKLQELFDTTLSVVDLFKYPTIHTIVEYLTKKDSLE
GSSQDGIARAKLRTSAVNQRDVAIIGMACRFPGAENISQFWQNLCDGVESISFFSKEEVL
NEGIHKQRLENKNYVKAAPIIKNIEEFDANFFGYSTREAMIIDPQQRLFLECAWEALEDA
GYDGNTYEGAIGMYAGAGMNTYFMHNLFPNRNQFNAEDGPNLMMLDSMGGFQIQIANDKD
YLPTRVSYKLNLKGPSLNVQTACSTSLVAIHTAYQSVVSGECDMALAGGVSVSVPQKAGH
LYEDGMILSPDGHCRAFDAKAQGTIFGNGSGIVLLKRLNEAIADGDHIYCVIKGSAINND
GAMKVGYSATSQEGQATGVTESIALAGINAETITYFETHGTGTSMGDPIEVAAMTQAFRS
TTNKLGFCAIGSVKTNVGHLQIASGVAGFIKTALALKYKKIPPILHFDQPNPLIDFANSP
FYVNKKLQDWKTDGIPRRAGVKSLGIGGTNACLILEEPPNQVKTGRGEGSKNNDYQERSL
HLLTLSAKTPKALEELVSRYEHHLESNVELEIADICYTANTGRSHFDHRLAIIAPDTQVL
TDELVKISAKEEINGVFTGKPSSNNQSSLIAFLFTGQGSQYINMGRQLYKTQPVFRQTLE
QCEQILQPYLKKSILDIIYPEDNQKLNSSIIDQTAYTQVALFAIEYALYKLWESWGIKPD
VVMGHSAGEYVAATVAGIFSLEDGLKLIAHRGRLMQQLSSGGEMLSVMASIEKVNQLIAP
YSQKVAIASINGPQSIVISGEAEAIGAVQNSLEAEDIKTKRLQVSHAFHSHLMEPMLADF
EAVASEITYNQPNIPLVSNVTGARAENSIATASYWVNHVRQPVKFAQSMDALQQEGYSIF
LEIGPKPTLLGMGRQCLPEDVGVWLPSLRPGQEDWQQMLQSLAELYVHGVKVDWLGFDKD
YSRSKVVLPTYPFQRQRYWIEASQGYTKQLNQQMYPLLGIKVELPSTEQIIYHQHINLTS
HPWIRDHKLYETDVIPGVSYIAMTFAAVGTPVAVEEVNFIQPLILATANTTRETELLIHP
ADTTQTKQKVQVFSRDTTSKDQWEQHAEMTLVKTPPSLPVLNLDIKALKQKLRAIDNDNL
KEIYNQMYVNTGFWIGPMLDAMRQVWVGEGTYLGEIEVPQALESQLAGEPIHPALLDACA
RATPEILDSRLDEPGVFWTPWKVQGMTLSRPAPRRFYAYVNQPTRFNEQLQTRTFDMHLL
DEKGQSFGRIDGFTLRRAPREKFLRSLQLTQTESITDWLYSVEWRSKGLLGRLPAPDFLL
TPVEIEQKLTKDLTELVTQIDDNSTLLFARSLEELSVDYIVQGLLSMGWSYKLGETFDSD
TAAQRLGVVPTQQRLFKRLLQILSEAGILECKQQQWKVGQTLEKVNPTGKNQNLLRQAPD
EAATLTLLDRCGTQLYGVLRGAVDPVQLVFPQGDLTTATQLYEDSSAAKVMNTIVQKVIT
QGTEKLPPTRGIRLLEIGAGTGGTTSYVLPNLNPSQAQYLFTDIGALFTGKAQEKFRDYK
FLKYQTLDIEEDPATQGFEYYQYDVIIAANVLHATTNIKQTLSNVKQLLAPGGMLVLYEA
TTRTSWVDLVFGLLEGWWKFQDYQLRPDYPLLSRSNWKKVLEDTGFTQVVTLPEVQGMPE
ILSQQAVIIAQAPQTIECTGSTAKSWLLFADDKGVAQQLARQLNSHGDVCTLVFAGDKYE
QIAPTEFTINPNNLSEYELLIRELATSSPSLNGVVQCWSISSGVSKTINSDELEKLSFNG
CGTTLFLLQALVKGGLSQPPWLWLVTSGSQPVPTNHPVIPGVAQSSLWGMGKVINLEHPE
LNCVRIDLDPLQAIEDQVNALFNEIWSLDKEDQVAWRGNSRYVARLVPSSYRQTLIEGRQ
SSSDNVNTQKPLSFRSDATYLITGGMGGLGLLVAHWMVSKGAKNLVLVGRSSPDEAAKKK
LTELEMAGAAVVVEKADVSDITAITRVLHNIENSKIPLAGIIHSAGMLSDRVLANQTWSS
FEKVMAAKVQGAWHLHQLTQNQSLDFFVLFSSVASLLGSSGQGNYSAANGFLDGLAHYRQ
AMGLPGLSLHWGAVSQVGEAAERGVETRIHQQGMGVISPNQMLECLELLMSGNARPEGKL
SDAEVGIVPIEWSAWQEKVANWTFLSDWQKIIQTTYGVTGSEFLSKLEAAATEERRSLLV
AHIRRQLSLVVGINNPESISLETGFFDLGMDSLTSVELRNKLQTSLSCSVPSTLAFDYPT
VGKLVDYLVSNVLSMEFCNLSDDLELQNENETELTIPAELEELSESDAEVLLLEKLRNIS
Y
selected fasta
>polyketide synthase [CrpA]
ATGATTACACCTTCACATGAAAATTTAGGTGCAAATGTACAAGCACTAAGTAACAGTGGG
TATCTGGGTATGCCAGCAGATGCTCCAAAAAGTTTGTCAGAAGTTTTACAAAGAGCAGTC
AAAAAGCATTCTGGGCGAGGCTTAACATATATTAACTTGGATGGCTCTGAGTATAATCAA
TCGTATCAAGATTTACTTGAGGAAGCGCAAAAAATCTTGGGAGGGTTAAGGAAACTGGGA
CTCAAACCCCAAGACAAAGTAATTTTTCAGTTAGAACGAAATCAAGATTTTATTGCTGGT
TTTTGGGGTTGTATTTTAGGAGGTTTTATCCCTATACCAGTTCCTGTGCCAATTAATTAT
GAAGAAGGCAGTAATAGTACTAACAAGCTTCATCATATTTGGCAGCTATTAGAACAATGT
TTGATCCTAACAGATATTAAATCAGTATCGAAAATACGACCTTTGTCAAAACTATTTCAA
TCAGAGCAGTTTGAGACAATCGCCATTGATGAGTTACGAGAGTGCGAACCAGATAAAAAC
TTGTATGTCAGCCAACCAGAAGATTTAGCATTGCTAATGCTTACTTCCGGTAGTACAAGT
ATACCCAAAGCGGTAAAAATCTCTCATCAGAACTTGTTAAGTATGACGGCAGGCACAATC
GTGATGAATGGCTTTAACCGTCAGGATGTAACCTTGAATTGGATGCCGATGGATCACGTG
GGAGCGCTAGTGTTCCTTAGCATTATGGCAGTGGATTTGGGTTGTCAGCAAGTTCACATA
CCAACGGAATACATTTTGCAAAATCCTCTCAACTGGCTAGATTTGATTACTCGTCACCAA
GGAACAATTAGCTGGGCTCCGAATTTTGCCTTTACCTTATTGTGCGATCGCGCCGAAGAA
ATTAGCCGTAAACATTGGAATTTATCTTCCATGAGGTTTTTGGTAAATGCTGGGGAACCT
GTTATCGCCAAAACTGCGCGAAATTTCCTGAAATTACTGGGTCAACATGGGTTACCATCC
ACTGCACTGCACCCAGCTTTTGGTATGTGCGAAACCTGTTCAGGAATCACTTGGTCAAAT
AGTTTCTCTTTGGAAACCACCTCAGACGAGGATACCTTTGTTTCGGTTGGTGGTCCCATA
CCCGGAGCATCTGTGCGGATTGTAGATGAAAATCAACAAGTGGTGGAAGAGGGGACAATT
GGACAGCTGCAACTTCAGGGAAATTCAGTAACCATAGGCTACTACCAAAATGAGGAGGCG
AACCAAGAAGCTTTTACAAAAGATGGTTGGTTTAACACAGGTGATTTAGGATTTTTAAAA
GGTGGATGTTTAACAATTACAGGACGACAAAAAGATGTAATTATTGTTAATGGAGTAAAT
TATTATAGTCATGAGATAGAAGCTGTTGTTGAAGAATTAGGAGAGGTTGAAGTTTCTTAT
ACCGCTGCTTGTGCAATTTGGAATGAAAATAGAAGTACAGATAGATTAGCTATATTTTTT
AACACAGAAAAGACTATTGATAATGGTTTAGTGGAGCTAATTAAATCAATTCGCACTCAC
GTTGTCAAATCTATTGGGATTAATCCTAATTACTTAATTCCGTTAGAAAAGACAACTATT
CCGAAAACTTCTATCGGTAAAATTCAAAGAAAACAATTAAAAGAACGGTTTGAAAACGGA
GAATTTAAGGAAATTGTTGCTCAAATTAGCACAGCTTTGGCTGAATTAAAGGCACAGAAT
TTTGTTTCGGGGAATGAGTTGGAACGTGATGTAGCCGAGATTTGGCAAGGAGTATTACAG
ATTCCGGAAGTGGGGATTCACGATAACTTTTTTGAGTTGGGTGGACATTCTGTAATGCTA
GCACAAGTTCACAGTAAGCTACAGGAATTATTTGACACAACCTTGTCAGTTGTAGATTTA
TTTAAATATCCGACAATTCATACAATAGTTGAATATTTGACAAAAAAAGATTCATTAGAG
GGATCATCCCAAGACGGAATTGCCCGTGCGAAATTGCGAACATCAGCAGTTAATCAAAGA
GATGTAGCGATCATTGGCATGGCTTGTCGCTTCCCAGGAGCAGAAAATATTTCTCAATTT
TGGCAAAATTTATGTGATGGAGTGGAATCAATTTCTTTTTTCTCTAAGGAAGAAGTCCTG
AATGAAGGTATTCACAAGCAACGATTGGAGAATAAAAACTACGTTAAAGCTGCACCTATT
ATCAAAAACATCGAAGAATTTGATGCCAACTTTTTTGGCTATAGTACACGAGAGGCGATG
ATCATAGATCCCCAACAACGCTTATTCCTTGAGTGTGCTTGGGAAGCACTTGAAGATGCT
GGTTACGATGGAAACACCTATGAAGGTGCAATTGGTATGTATGCAGGTGCGGGGATGAAT
ACATACTTCATGCACAATTTATTCCCCAATCGGAATCAGTTTAATGCTGAAGATGGACCT
AATTTAATGATGCTGGATTCTATGGGAGGATTCCAAATTCAAATTGCTAATGATAAAGAC
TATTTACCTACAAGAGTATCTTATAAATTAAATCTCAAGGGTCCAAGTCTGAATGTACAA
ACGGCTTGTTCAACTTCTTTAGTAGCGATCCACACAGCTTATCAAAGTGTGGTCAGTGGG
GAGTGCGACATGGCTTTAGCGGGGGGAGTATCGGTTAGTGTGCCCCAAAAAGCAGGTCAT
TTATATGAAGATGGGATGATTTTGTCTCCTGATGGACATTGTCGCGCCTTTGATGCTAAA
GCTCAAGGTACGATTTTTGGCAATGGTTCAGGAATAGTTTTATTGAAGAGATTGAATGAA
GCCATCGCCGATGGGGATCATATTTACTGTGTGATTAAAGGGTCAGCCATTAATAATGAT
GGAGCTATGAAAGTGGGGTATTCTGCTACTAGCCAGGAAGGCCAAGCTACTGGTGTGACT
GAGTCGATTGCTTTAGCAGGAATTAACGCTGAAACTATTACTTATTTTGAAACTCATGGT
ACAGGAACTTCCATGGGAGACCCCATTGAAGTGGCAGCTATGACTCAGGCTTTTAGATCA
ACTACTAATAAATTAGGATTTTGTGCTATTGGTTCGGTAAAAACAAATGTAGGACATTTA
CAAATTGCTTCCGGAGTTGCAGGGTTCATAAAAACTGCATTAGCTTTAAAATATAAGAAA
ATACCACCAATCTTACATTTTGACCAACCCAACCCTTTGATTGATTTTGCCAATAGCCCA
TTTTATGTAAATAAAAAGTTACAAGACTGGAAAACTGATGGAATTCCTAGACGTGCAGGG
GTTAAATCACTGGGAATTGGTGGTACAAATGCTTGTTTAATTTTGGAAGAACCACCGAAT
CAAGTCAAAACAGGTCGTGGGGAGGGAAGCAAAAATAATGATTATCAGGAGCGTTCGCTT
CACCTGTTAACTTTGTCAGCTAAAACACCAAAAGCACTCGAAGAGTTGGTCAGTCGTTAT
GAGCATCATCTGGAAAGCAACGTAGAGTTAGAAATAGCAGACATCTGTTATACAGCTAAT
ACAGGACGTAGTCATTTTGATCATCGATTAGCAATTATCGCCCCTGACACTCAAGTTTTA
ACTGATGAATTAGTAAAAATTAGTGCGAAAGAAGAAATTAATGGTGTATTCACAGGAAAA
CCTTCTAGTAATAATCAATCATCATTAATTGCCTTCCTGTTTACTGGACAAGGTTCACAG
TATATAAATATGGGAAGGCAACTCTATAAAACCCAACCTGTCTTCCGTCAAACCTTAGAG
CAGTGCGAACAAATTCTACAACCATATTTAAAAAAATCGATTTTAGATATTATTTACCCA
GAAGATAATCAAAAATTAAACAGTAGTATTATTGACCAAACCGCCTATACCCAAGTAGCT
TTATTTGCAATAGAATATGCTCTTTATAAACTATGGGAATCCTGGGGAATAAAACCGGAT
GTGGTGATGGGGCATAGTGCTGGGGAATATGTGGCAGCCACAGTAGCAGGAATATTTAGT
TTAGAAGATGGTTTAAAACTGATTGCTCATAGAGGAAGACTAATGCAACAGTTATCCTCT
GGGGGTGAAATGTTATCTGTAATGGCTTCAATTGAAAAGGTAAATCAACTAATTGCACCA
TACTCTCAAAAAGTAGCGATCGCATCGATTAACGGACCCCAAAGCATTGTCATTTCTGGT
GAGGCAGAAGCAATTGGAGCGGTTCAAAATAGCTTAGAAGCAGAAGACATTAAGACAAAA
CGACTGCAAGTATCTCACGCATTCCATTCACATTTGATGGAACCAATGTTGGCGGACTTT
GAAGCAGTAGCATCAGAAATAACCTACAATCAACCAAATATTCCATTAGTATCAAATGTA
ACGGGAGCTAGGGCAGAGAATAGTATTGCCACAGCAAGCTATTGGGTAAATCATGTCCGG
CAACCGGTGAAATTTGCCCAAAGTATGGACGCATTACAGCAAGAAGGTTATTCCATCTTC
TTAGAAATTGGACCCAAACCAACTTTGTTAGGCATGGGAAGACAGTGCTTGCCAGAAGAT
GTGGGAGTTTGGTTGCCTTCTTTGAGACCAGGTCAAGAAGACTGGCAGCAAATGCTACAA
AGTTTGGCTGAACTATATGTGCATGGAGTTAAAGTTGATTGGTTAGGGTTTGATAAAGAT
TATTCTCGTAGCAAGGTAGTATTGCCGACTTATCCCTTTCAACGGCAACGTTATTGGATC
GAGGCTTCCCAGGGATATACGAAACAACTGAATCAACAAATGTATCCACTATTGGGAATT
AAGGTAGAACTACCATCCACCGAGCAGATAATTTACCACCAGCATATCAATCTAACCAGT
CATCCCTGGATTAGAGACCACAAACTCTACGAGACGGATGTAATTCCCGGTGTGAGCTAT
ATTGCCATGACATTTGCAGCTGTGGGTACACCAGTAGCGGTGGAGGAGGTTAACTTTATA
CAACCTCTAATTTTGGCAACCGCCAATACTACCCGTGAAACAGAACTGTTGATTCACCCT
GCTGATACTACCCAGACTAAACAAAAAGTACAAGTTTTTAGCCGAGATACTACCTCCAAA
GACCAATGGGAGCAGCATGCTGAAATGACTTTAGTGAAGACCCCCCCGTCTTTGCCAGTT
TTAAACCTAGACATCAAAGCTCTCAAGCAAAAGTTGAGAGCAATTGATAATGATAATTTA
AAAGAAATTTACAACCAAATGTATGTGAACACAGGCTTCTGGATCGGTCCGATGCTGGAT
GCAATGCGTCAGGTTTGGGTAGGCGAAGGAACTTACCTTGGGGAAATCGAAGTGCCACAA
GCCTTGGAATCCCAACTTGCTGGGGAACCAATCCATCCAGCTCTTCTTGATGCCTGTGCT
CGCGCAACTCCTGAGATTTTAGATTCTCGTCTTGATGAACCAGGAGTATTTTGGACTCCA
TGGAAGGTGCAGGGGATGACCCTGAGTCGTCCAGCTCCGCGCCGTTTCTATGCCTATGTT
AATCAACCCACTCGATTCAATGAACAATTGCAGACCCGTACTTTTGATATGCATCTACTA
GATGAAAAGGGTCAGTCCTTTGGTCGCATTGACGGTTTTACCCTTCGACGTGCTCCCCGT
GAAAAATTTTTGAGGAGTTTGCAACTTACACAAACGGAATCAATTACAGATTGGTTGTAT
TCTGTGGAATGGAGAAGCAAAGGTCTTTTGGGTAGGCTGCCAGCCCCTGATTTCCTGTTA
ACACCAGTAGAAATAGAGCAAAAACTGACGAAGGACCTTACAGAATTAGTTACTCAGATA
GATGACAATAGTACTTTGCTTTTCGCAAGAAGCTTAGAGGAATTAAGCGTAGATTATATA
GTGCAAGGACTGCTGTCAATGGGTTGGTCATACAAACTGGGAGAGACTTTTGACTCCGAT
ACAGCAGCCCAACGCTTAGGAGTAGTTCCAACTCAGCAGCGATTATTCAAGCGTTTATTA
CAAATATTATCAGAAGCGGGCATTCTTGAGTGCAAACAACAACAGTGGAAGGTTGGACAA
ACCTTGGAAAAAGTCAACCCCACGGGAAAAAACCAGAATTTACTTCGCCAAGCTCCAGAT
GAAGCTGCAACATTGACATTATTAGACCGTTGTGGTACTCAACTGTATGGGGTACTGCGA
GGAGCAGTAGACCCAGTGCAACTGGTTTTCCCCCAAGGAGATTTAACTACAGCAACCCAA
CTGTATGAAGATTCAAGTGCAGCCAAGGTGATGAACACTATTGTGCAAAAAGTCATCACC
CAAGGCACCGAGAAACTACCTCCGACAAGAGGAATACGGTTATTGGAAATTGGAGCTGGA
ACAGGAGGAACCACTAGTTATGTTCTACCCAATCTAAATCCAAGCCAGGCACAATATCTG
TTCACAGATATTGGAGCATTATTCACTGGTAAAGCCCAAGAAAAATTCCGTGATTATAAA
TTTTTAAAATATCAAACCTTAGATATTGAAGAAGACCCAGCAACCCAAGGATTTGAATAT
TATCAATATGATGTAATTATTGCAGCCAATGTCCTCCATGCAACAACTAATATCAAGCAA
ACACTATCCAATGTGAAGCAATTGTTAGCACCAGGGGGAATGTTAGTTTTGTATGAAGCA
ACAACTCGCACAAGTTGGGTGGATTTAGTCTTTGGATTGTTAGAAGGATGGTGGAAGTTC
CAAGATTATCAATTAAGACCAGACTATCCTCTGCTAAGTCGTAGTAATTGGAAGAAAGTG
TTAGAGGATACAGGTTTTACTCAGGTAGTTACCTTGCCAGAAGTTCAAGGAATGCCAGAA
ATATTGTCTCAACAAGCAGTAATTATAGCTCAAGCACCTCAAACAATTGAGTGCACTGGA
TCAACAGCGAAGAGTTGGTTGCTATTCGCAGATGATAAAGGAGTTGCTCAACAACTAGCA
AGACAACTAAATTCTCATGGAGATGTTTGTACCTTAGTATTTGCTGGGGACAAATATGAA
CAAATTGCCCCAACAGAGTTTACTATTAACCCCAATAACCTATCAGAATATGAGCTACTC
ATAAGGGAACTAGCAACATCTTCACCATCATTAAACGGAGTAGTGCAATGTTGGAGTATC
TCTTCAGGAGTAAGTAAAACTATCAATTCTGACGAATTAGAAAAGTTATCTTTCAATGGG
TGTGGCACCACCTTATTTTTGCTACAGGCATTAGTCAAAGGGGGGTTATCTCAACCACCC
TGGTTATGGTTAGTAACTTCTGGTTCTCAACCAGTACCGACGAATCACCCAGTCATACCA
GGAGTTGCCCAATCTTCACTATGGGGAATGGGTAAAGTGATTAACTTAGAACACCCAGAA
CTCAACTGTGTACGCATAGATTTAGACCCACTGCAGGCCATAGAAGATCAAGTAAATGCA
CTATTTAATGAAATCTGGTCTCTGGATAAGGAAGACCAGGTAGCATGGCGTGGTAATTCT
CGTTATGTAGCTAGGTTGGTGCCCAGTTCTTATAGGCAAACCTTGATCGAAGGACGACAG
TCATCATCAGATAATGTAAATACTCAAAAGCCTTTAAGTTTCCGCTCCGATGCTACCTAC
TTAATTACCGGAGGTATGGGAGGTTTGGGCTTACTAGTAGCCCATTGGATGGTATCCAAG
GGAGCCAAGAATTTAGTCTTGGTAGGGCGCAGTTCACCGGATGAAGCCGCCAAGAAAAAA
CTCACGGAGTTGGAAATGGCCGGAGCGGCAGTGGTAGTAGAAAAGGCAGATGTGTCTGAT
ATTACAGCTATTACAAGAGTGCTGCATAACATTGAGAACTCCAAGATACCATTAGCGGGG
ATAATTCATTCTGCGGGAATGTTATCTGATCGGGTATTGGCAAATCAAACTTGGTCAAGC
TTTGAGAAAGTGATGGCTGCCAAAGTCCAGGGAGCTTGGCATCTGCATCAATTAACTCAA
AATCAGTCATTGGACTTTTTTGTGTTGTTTTCTTCTGTTGCATCCCTGTTGGGTTCTTCT
GGTCAAGGAAATTATTCTGCAGCCAATGGGTTTCTTGATGGTTTAGCCCATTATCGTCAA
GCTATGGGACTACCAGGATTGAGCTTGCATTGGGGGGCAGTTTCTCAAGTGGGAGAGGCT
GCAGAACGAGGTGTCGAAACTAGGATTCATCAACAGGGTATGGGTGTGATATCTCCGAAC
CAGATGTTAGAATGCCTAGAATTACTAATGAGTGGTAATGCTAGACCGGAAGGTAAGCTA
TCAGACGCTGAAGTAGGGATTGTGCCAATTGAGTGGTCAGCATGGCAAGAGAAAGTAGCC
AATTGGACATTTTTGTCAGATTGGCAAAAAATTATCCAAACAACTTATGGTGTAACTGGC
TCGGAATTTCTGTCTAAGTTGGAAGCTGCAGCGACCGAGGAGCGTCGTTCCCTATTAGTG
GCTCATATCCGTCGTCAATTATCCTTAGTCGTGGGAATCAATAATCCCGAATCTATTTCA
TTAGAAACTGGCTTTTTTGACCTGGGTATGGATTCTTTAACTTCTGTGGAGTTGAGGAAT
AAGTTGCAAACTAGTTTGAGTTGTTCGGTACCATCTACTTTGGCTTTTGATTATCCTACA
GTTGGTAAGCTAGTAGATTATCTAGTATCAAATGTTCTTTCTATGGAATTTTGTAATTTA
TCTGATGATTTGGAGTTGCAAAACGAGAATGAAACTGAATTAACAATTCCTGCAGAGCTA
GAAGAACTTTCGGAATCAGACGCTGAAGTTTTGCTTCTTGAGAAACTTAGAAATATTAGT
TACTGA
[0] A61..477
[0] PCP587..654
[1] KS680..1068
[1] AT1232..1552
[1] malonyl-CoA1426..1430
[1] DH1595..1735
[1] CM2115..2215
[1] KR2538..2717
[1] ACP2819..2889
[0] A181..1431
[0] PCP1759..1962
[1] KS2038..3204
[1] AT3694..4656
[1] malonyl-CoA4276..4290
[1] DH4783..5205
[1] CM6343..6645
[1] KR7612..8151
[1] ACP8455..8667

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [61-477]  2.50000000000001e-85 PF00501
PF00501   AMP-binding
IPR001227 Acyl transferase domain (Domain)
 [1223-1358]  1.10000000000001e-90 G3DSA:3.40.366.10 [1426-1541]  1.10000000000001e-90 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [2847-2862]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [587-654]  PS50075 [2819-2889]  PS50075
PS50075   ACP_DOMAIN
 [580-655]  9.19998414420358e-19 SSF47336 [2812-2892]  3.1999989904635e-20 SSF47336
SSF47336   ACP_like
 [590-653]  1.1e-12 PF00550 [2828-2888]  1.3e-12 PF00550
PF00550   PP-binding
 [585-656]  4.39999999999997e-39 G3DSA:1.10.1200.10 [2818-2891]  1.1e-32 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013217 Methyltransferase type 12 (Domain)
 [2115-2215]  3.2e-19 PF08242
PF08242   Methyltransf_12
IPR013968 Polyketide synthase, KR (Domain)
 [2538-2716]  1.5e-69 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [680-941]  3.30000000000002e-69 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [949-1068]  1.2e-34 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [1232-1552]  1.39999999999997e-69 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [1228-1546]  1e-77 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [1360-1425]  5.39999384454126e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [679-952]  8.60000000000004e-75 G3DSA:3.40.47.10 [953-1121]  1e-52 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [672-1120]  1.59998835313644e-79 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2537-2751]  9.20000000000002e-43 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [854-870]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [1233-1532]  SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [588-657]  9.30000048475975e-06 SM00823 [2820-2892]  2.30000440726534e-22 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1595-1735]  7.19999557654549e-11 SM00826
SM00826   PKS_DH
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2538-2717]  7.79998304125571e-60 SM00822
SM00822   PKS_KR
IPR020845 AMP-binding, conserved site (Conserved_site)
 [192-203]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit
first first   Crypto_00020 Crypto_00020