close all open/close all

CDS information : Crypto_00030


close this sectionLocation

Organism
StrainATCC 53789
Entry nameCryptophycin 1
Contig
Start / Stop / Direction29,220 / 35,051 / + [in whole cluster]
29,220 / 35,051 / + [in contig]
Location29220..35051 [in whole cluster]
29220..35051 [in contig]
TypeCDS
Length5,832 bp (1,943 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)CrpC
Gene
Gene (GenBank)crpC
EC number
Keyword
Note
Note (GenBank)
  • non-ribosomal peptide synthetase; C-A-OM-PCP-E
Reference
ACC
PmId
[17240975] Biosynthetic characterization and chemoenzymatic assembly of the cryptophycins. Potent anticancer agents from cyanobionts. (ACS Chem Biol. , 2006)
[17240971] Cryptophycin anticancer drugs revisited. (ACS Chem Biol. , 2006)

close this sectionPKS/NRPS Module

4 L-tyrosine
C60..356
A555..947
OM990..1265
PCP1389..1459
E1472..1937

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [CrpC]
MNLIEFLQDISIKGWQVWSEGERLCYDAPQEESTALVLAQLKQYKTEILQLLRDRPDILN
VYPLSYGQRALWFLWQLAPESHAYNVSFVARICSTVDITAMQKAFEKLIERHPILRTNYP
KLGSESIQQVNNFQELNFLQIDASAWSEDELKGKVIESHQQYFDLERGPVMRVRWFTRSK
KEHVLLLTIHHIACDAWSLDMLIQELPQLYQVQWADFKTPLSPLKHSYQDYVRWQRNILQ
ETEGERLWNYWQQKLTGDLPALNLATSRQRPPIKTYNGASHHFKLSDKLTKQLKELALNS
GATLYMMLLATFQVFLYRYTGQEDILVGSPTSGRSQAKFASILGYFVDPVVMRANLSGNP
SFKDFLAQVRQTVLEALAHQDYPFALLVEKLQPHRDPSRSPIFQASFSLLQFQKSQDIQK
LFVNQIETYVDWGELKIKPYEIPQQEGQLDLGLEMVEGSSSVFGVFKYNTDLFDESTIER
MAGHFQNLLSAIVENPQQKVSESPLLSEVERHQLLVEWNDTAREYPSKCIHQLFEEQVER
TPDAVAVVFENQQLTYQQLNQKANQLAHHLLSLRVEPEVLVGIYVERSFEMVVGLLGILK
AGGAYVPLDPNYPQERLSYMLADSGVEVLLAQKSLLESLPSHTAQVVCLDSDWGVIEQHS
QENLDVGVCSDNLAYVIYTSGSTGVPKGVGIEHFSLCNLIQAQKNLFYLEPNSRVLQFAS
ISFDASVSEIFIALTSGAMLILAIASELIPGSDLKQILQERCVTHVTLPPSALAVLATDE
FPALGQIIVAGEACNLELANQWSVGRRLFNGYGPTESTIGAAVAQISHGSEKVTIGRPIA
NTQIYILDKHLEPVPISVSGELYIGGYGLARGYLNRPELTLEKFIPNPFNSRSKLYKTGD
LARYLPDGNIEFLGRLDNQVKIRGFRIELGEIESVLSTHPQVQQVAVTEREDTPGHKRLV
AYLVPLQSKEKDPQPQTGIELWPSVAEFYVYDELLYYAMTNDHRRNQSYQVAINQMVKDK
VVVEIGTGKDAIIARFCAEAGAKKVYAIERDEQTSKLASACVQELGLSEQIQIIHGDATT
ANLPEEVDVCVSEIVGPIGGSEGAAVIINNARRFLKSDGVMIPQRSVTQIIAVTLPDELL
NQPQFTKVSGYYTQKIFEQVGYPFDLRVCIKGLNQVNWLSNRGVFEDLDFSKLVSTESTH
QIKLTIEKSGRLDGFSVGLNLHTIEGECIDILENEHCWLPVYLPVFEPGIYVNEGDIIEA
VCTRTLCENNLNPDYTLRGRLLKKTGKEIEFEYISYHWKQLFKQNPFYQRLFAENNLEDY
TINKSKPERKVLSSNELRSYLKSKLPEYMLPSSFVILDTLPLTPNGKVDRKALSAPDGEV
SREDEYVAPRTEIEQILTNIWQELLLKEQVSIHDNFFEIGGDSILGIQVVSRAKNLGIQI
TPKQIFQNQTIAKLALVANTTVTVSANQGIVTGVAPLTPIQQWFFAQNSQEAHHYNQSVL
LQIPNHLQTELIETALKKLLEHHDALRLRFTSVASEYKQINHGFDDPVAFTVVDLSSTPV
IEQPQALSQIATEYQASLNLSEGPLMQVVMFNLGSEVDARLLIIIHHLAVDGVSWRILLS
DLETIYQQLIAQQSIQLNAKTTAFIDWAEKLKNYAQSEKIKQELDYWLNQPWSETTPLPL
DSAHTQAEKTVDSAINYRVKLSPEETRALLGSVNSAYNTQINDILLSALVVSLAEWTGDS
KVLIDLEGHGREELFSDVDLSRTIGWFTSLFPVLLRLPDDKQPAEVIKSIKEQLREIPHR
GIGFGILRYLCEDTTVTQKLQTIPTPEISFNYLGQFDQIQSETGWKFAPESTGDNHSSKQ
TRHHLLEINSLVVEGELQIDWTYSSNFHTHDTVKNLTQSYIQAIKSIIEHCQSENGFGYT
ASDFPDAQLNQLELDELLKNLGK
selected fasta
>non-ribosomal peptide synthetase [CrpC]
ATGAATTTAATCGAATTTTTACAAGATATTTCAATAAAAGGTTGGCAAGTGTGGAGTGAG
GGCGAACGGCTTTGTTACGATGCTCCTCAAGAAGAATCAACTGCTTTAGTATTAGCTCAA
CTGAAACAATACAAAACCGAAATATTACAATTGCTGCGCGATCGCCCAGATATTTTAAAC
GTCTATCCCCTTTCTTACGGTCAACGGGCACTTTGGTTTTTGTGGCAATTAGCACCAGAA
AGTCATGCTTATAACGTATCATTTGTCGCTCGTATTTGCTCAACAGTAGATATTACAGCA
ATGCAAAAGGCATTTGAGAAACTAATAGAACGGCATCCGATATTGCGTACAAATTATCCC
AAACTCGGATCTGAGTCAATCCAACAGGTAAATAATTTTCAGGAATTAAATTTCTTGCAA
ATTGATGCTTCTGCTTGGAGTGAAGATGAACTGAAAGGGAAAGTGATTGAGAGCCATCAA
CAATATTTTGACCTCGAACGAGGGCCTGTTATGCGAGTTCGGTGGTTTACTCGTTCCAAG
AAAGAACATGTCCTGTTGCTAACCATACACCACATTGCTTGCGATGCCTGGTCTTTAGAT
ATGTTAATACAGGAGTTGCCACAACTCTACCAAGTACAATGGGCTGATTTTAAGACACCC
CTTTCTCCTCTAAAGCATTCTTACCAAGATTACGTTCGTTGGCAGAGGAATATTTTGCAG
GAGACTGAAGGGGAAAGACTCTGGAACTACTGGCAGCAAAAACTGACAGGCGATTTGCCA
GCACTAAACCTAGCAACCTCAAGACAGCGACCACCGATAAAAACTTATAATGGTGCTTCC
CATCACTTCAAATTATCTGACAAGCTCACTAAGCAACTCAAGGAGCTGGCTTTAAACTCG
GGAGCAACACTTTACATGATGCTCTTAGCAACTTTTCAGGTGTTTTTGTATCGTTACACA
GGCCAGGAGGATATTTTAGTCGGTTCTCCCACCTCAGGTAGGAGTCAAGCTAAGTTTGCT
TCGATCTTGGGCTACTTTGTTGATCCTGTTGTTATGCGAGCAAATTTATCGGGAAATCCC
AGTTTCAAAGATTTCCTCGCCCAAGTACGCCAAACCGTATTGGAAGCACTTGCTCATCAA
GATTACCCATTTGCTCTATTGGTAGAAAAGCTACAGCCACACCGCGACCCCAGTCGTTCG
CCGATTTTTCAGGCTTCTTTTTCTCTACTGCAGTTCCAAAAATCTCAAGATATACAGAAG
TTGTTTGTAAATCAAATAGAAACCTATGTTGATTGGGGAGAATTGAAGATAAAACCTTAT
GAAATACCTCAACAGGAAGGTCAGTTAGATTTAGGTTTAGAAATGGTGGAGGGGAGTTCA
TCTGTTTTTGGGGTTTTTAAGTACAACACTGACTTGTTTGATGAGTCAACCATTGAGCGC
ATGGCTGGTCATTTCCAGAATTTATTGTCAGCGATTGTGGAAAATCCTCAACAAAAGGTA
AGTGAATCACCCCTATTGAGTGAAGTAGAACGGCATCAGTTGTTGGTGGAGTGGAATGAT
ACAGCAAGGGAATATCCCAGTAAATGTATCCATCAATTGTTTGAAGAGCAGGTAGAGAGA
ACACCGGATGCAGTCGCGGTGGTATTTGAGAATCAGCAGTTAACCTACCAACAATTAAAT
CAAAAAGCCAACCAACTAGCACATCACCTGCTTTCCTTGCGAGTCGAACCAGAGGTGCTG
GTAGGGATTTACGTGGAGCGTTCTTTTGAAATGGTGGTAGGGCTCTTGGGGATACTCAAG
GCTGGTGGGGCTTATGTACCCCTTGACCCCAATTATCCCCAAGAACGGTTGAGTTATATG
TTGGCGGATTCAGGTGTTGAGGTGTTGTTGGCTCAAAAGTCCCTACTGGAATCTTTGCCG
TCACATACTGCACAGGTGGTTTGTTTGGATAGTGATTGGGGAGTGATTGAGCAACACAGT
CAGGAGAATCTTGATGTTGGGGTATGTTCAGATAATTTGGCTTATGTGATTTATACTTCT
GGTTCTACTGGAGTTCCCAAGGGGGTTGGGATTGAACATTTTTCTTTGTGCAACCTTATT
CAAGCACAGAAAAATTTATTTTATCTAGAACCAAATAGTCGTGTTCTTCAATTTGCTTCT
ATAAGTTTTGATGCTTCAGTTTCGGAAATATTTATCGCTTTGACTTCTGGAGCAATGCTA
ATTTTGGCTATAGCTTCTGAGTTAATCCCGGGTTCGGATTTAAAGCAAATTTTACAAGAA
AGATGTGTAACTCATGTTACGTTACCTCCCTCTGCCCTGGCAGTACTAGCTACTGATGAA
TTTCCAGCCTTGGGTCAGATAATTGTGGCAGGGGAAGCTTGTAATTTAGAATTGGCCAAT
CAGTGGTCTGTTGGTCGTCGTTTGTTTAATGGTTATGGGCCTACTGAGTCTACTATTGGT
GCTGCAGTGGCTCAAATCAGCCATGGTAGCGAGAAAGTTACTATCGGTCGCCCCATTGCA
AACACCCAAATCTATATCTTAGATAAGCACTTAGAACCAGTACCCATAAGTGTATCCGGA
GAATTATACATCGGAGGTTATGGCTTAGCCAGAGGTTACCTCAACCGACCGGAATTAACT
TTAGAGAAATTCATCCCTAACCCCTTCAATAGCAGATCAAAACTATATAAAACTGGAGAT
TTAGCTCGATACTTACCAGATGGTAATATTGAGTTTCTTGGTCGTCTTGATAACCAGGTG
AAAATACGTGGTTTCCGCATAGAACTAGGAGAAATAGAATCAGTTCTGAGTACCCATCCT
CAAGTACAGCAAGTCGCAGTCACCGAAAGGGAAGATACTCCGGGTCACAAACGGTTGGTA
GCATATTTAGTTCCTCTTCAGTCAAAAGAAAAAGATCCCCAGCCCCAGACAGGAATTGAA
CTTTGGCCCTCAGTAGCAGAATTCTACGTTTATGATGAGCTCTTGTACTATGCGATGACC
AATGATCATCGTCGAAACCAGAGTTACCAAGTCGCAATTAATCAAATGGTTAAAGATAAA
GTAGTTGTTGAAATTGGCACGGGCAAGGATGCAATTATAGCCAGATTTTGTGCAGAAGCA
GGTGCTAAGAAAGTCTACGCAATTGAGAGAGACGAGCAAACCAGTAAGTTAGCTTCAGCT
TGCGTGCAAGAGTTGGGGTTATCAGAACAAATTCAAATCATACATGGAGACGCTACTACA
GCCAACTTACCAGAAGAAGTTGATGTATGTGTTTCTGAAATTGTGGGACCCATTGGTGGA
TCTGAAGGAGCAGCAGTAATTATCAACAACGCCAGAAGATTTCTCAAATCAGATGGTGTA
ATGATTCCCCAAAGAAGTGTGACTCAAATTATTGCAGTAACTCTTCCTGATGAATTACTA
AATCAACCCCAATTTACAAAAGTTTCAGGTTATTATACCCAGAAGATATTTGAGCAAGTT
GGATATCCTTTTGATTTACGAGTATGTATTAAAGGATTAAATCAAGTAAACTGGTTGTCC
AATCGAGGAGTTTTTGAGGATTTAGACTTTAGCAAGCTTGTTAGCACAGAATCTACTCAC
CAAATTAAATTAACTATTGAAAAATCAGGAAGATTAGATGGTTTTTCAGTGGGATTAAAC
TTACACACAATTGAAGGAGAATGTATAGATATTTTAGAAAATGAACATTGCTGGTTACCA
GTTTATCTTCCAGTGTTTGAACCAGGAATTTATGTAAATGAAGGAGATATCATCGAAGCT
GTTTGTACGAGAACGCTTTGTGAAAATAATTTGAATCCAGATTATACTCTTCGAGGTCGT
CTTTTAAAAAAAACTGGAAAAGAGATTGAGTTTGAATACATCTCATATCATTGGAAACAA
TTGTTTAAGCAAAACCCTTTTTATCAACGATTGTTTGCTGAAAATAATCTAGAAGATTAC
ACAATTAATAAGTCAAAGCCTGAACGTAAGGTACTGAGTAGCAATGAATTGCGCTCCTAC
CTAAAGTCTAAATTGCCAGAATATATGCTCCCCTCTAGCTTTGTCATCTTAGACACCCTA
CCGTTGACACCCAACGGTAAAGTAGACCGCAAAGCCCTAAGTGCACCTGATGGGGAAGTT
AGCCGAGAGGATGAATATGTCGCACCACGCACAGAAATAGAACAAATCTTAACCAACATT
TGGCAAGAACTGCTCCTTAAAGAACAAGTCAGCATCCATGACAACTTCTTTGAAATTGGT
GGCGACTCCATCCTTGGTATTCAAGTAGTTTCTCGTGCCAAAAACTTAGGAATACAAATC
ACTCCCAAACAAATATTCCAAAATCAAACCATCGCCAAACTAGCATTAGTAGCCAATACA
ACAGTTACTGTCAGTGCTAACCAAGGTATAGTTACTGGAGTTGCACCCCTAACACCAATT
CAACAGTGGTTCTTTGCACAAAATAGCCAAGAAGCACACCATTACAACCAATCAGTTTTA
TTGCAGATTCCCAATCATCTGCAAACTGAATTAATCGAAACAGCCTTGAAAAAATTATTA
GAGCATCACGATGCTCTGCGTTTACGATTCACATCAGTTGCATCTGAGTACAAACAAATA
AACCATGGCTTTGATGATCCCGTAGCATTTACTGTAGTTGATTTATCATCAACTCCTGTC
ATTGAACAACCACAAGCTTTATCACAGATCGCCACGGAATATCAAGCAAGTTTAAACCTC
TCAGAGGGACCTTTAATGCAAGTGGTGATGTTTAACTTAGGTAGTGAAGTTGATGCCCGT
TTACTGATTATTATTCATCACCTAGCAGTAGATGGTGTGAGTTGGCGAATTTTACTATCA
GACTTAGAAACAATCTATCAACAACTAATCGCTCAACAATCAATACAGCTAAATGCGAAA
ACAACAGCATTTATTGATTGGGCAGAGAAATTGAAAAATTATGCACAATCAGAAAAAATC
AAACAAGAGTTAGACTATTGGCTCAACCAACCTTGGTCAGAAACAACACCACTACCATTA
GATTCTGCTCACACTCAAGCAGAAAAAACAGTTGATAGTGCGATTAATTATAGAGTGAAA
TTGAGTCCAGAAGAAACCCGCGCTTTGCTGGGGTCAGTAAACTCAGCTTATAACACACAA
ATTAACGATATCCTCCTCAGTGCATTAGTAGTTTCCTTGGCAGAGTGGACGGGAGATTCA
AAAGTACTAATTGACCTAGAAGGACATGGCAGAGAAGAACTATTTTCAGATGTAGACTTA
TCAAGAACAATAGGTTGGTTTACCAGTTTATTCCCAGTATTATTGCGATTACCAGACGAT
AAACAACCAGCAGAAGTTATCAAGTCAATTAAAGAACAATTACGAGAGATTCCCCATCGT
GGTATTGGCTTTGGTATATTGCGTTACTTGTGTGAAGATACTACTGTAACCCAAAAACTA
CAGACAATTCCTACTCCAGAAATTAGTTTTAACTACCTAGGACAATTTGACCAAATACAA
TCGGAAACGGGTTGGAAATTTGCGCCAGAATCTACTGGAGATAATCATAGTTCAAAGCAA
ACTCGTCACCATCTATTAGAGATTAATAGTCTGGTGGTAGAAGGTGAATTACAAATTGAT
TGGACTTATAGTAGTAATTTTCATACTCATGATACAGTAAAAAATTTGACACAAAGCTAT
ATTCAAGCAATTAAGTCAATAATAGAACATTGCCAGTCAGAAAATGGTTTTGGATATACA
GCTAGTGATTTCCCAGATGCACAGTTAAATCAATTAGAACTTGATGAGTTATTAAAAAAC
TTGGGCAAATAG
[4] C60..356
[4] A555..947
[4] L-tyrosine724..820
[4] OM990..1265
[4] PCP1389..1459
[4] E1472..1937
[4] C178..1068
[4] A1663..2841
[4] L-tyrosine2170..2460
[4] OM2968..3795
[4] PCP4165..4377
[4] E4414..5811

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [555-947]  6.20000000000009e-119 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [60-356]  3.70000000000004e-72 PF00668 [1472-1775]  1.69999999999998e-69 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1418-1433]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1397-1455]  7.59999999999999e-10 PF00550
PF00550   PP-binding
 [1384-1457]  2.6e-25 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1386-1455]  1.29999924468179e-16 SSF47336
SSF47336   ACP_like
 [1389-1459]  PS50075
PS50075   ACP_DOMAIN
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1784-1937]  8.60000000000004e-49 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [555-947]  TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [676-687]  PS00455
PS00455   AMP_BINDING
IPR025799 Protein arginine N-methyltransferase (Family)
 [990-1265]  1.5e-11 PF05185
PF05185   PRMT5
SignalP No significant hit
TMHMM No significant hit