close all open/close all

CDS information : Crypto_00040


close this sectionLocation

Organism
StrainATCC 53789
Entry nameCryptophycin 1
Contig
Start / Stop / Direction35,090 / 45,121 / + [in whole cluster]
35,090 / 45,121 / + [in contig]
Location35090..45121 [in whole cluster]
35090..45121 [in contig]
TypeCDS
Length10,032 bp (3,343 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)CrpD
Gene
Gene (GenBank)crpD
EC number
Keyword
Note
Note (GenBank)
  • non-ribosomal peptide synthetase; C-A-PCP-C-A-KR-PCP-TE
Reference
ACC
PmId
[17240975] Biosynthetic characterization and chemoenzymatic assembly of the cryptophycins. Potent anticancer agents from cyanobionts. (ACS Chem Biol. , 2006)
[17240971] Cryptophycin anticancer drugs revisited. (ACS Chem Biol. , 2006)
[21823639] Chemoenzymatic synthesis of cryptophycin anticancer agents by an ester bond-forming non-ribosomal peptide synthetase module. (J Am Chem Soc. , 2011)

close this sectionPKS/NRPS Module

5 alpha-methyl-beta-alanine
6 2-keto-isocaproic acid
C12..314
A501..968
PCP1052..1119
C1139..1440
A1899..2315
KR2660..2846
PCP2981..3048
TE3069..3321

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [CrpD]
MSNEEIRRNISSIYPLSPMQQGMLFHSLYAPYSGVYLEQMTWGLKGNINVAAFERAWQKV
LDRHSILRTFFVWENRQTPLQVVLKQVNVPWNTLDWRELSSNDQQQQLKQLLQTQREQGF
NLSQAPLMRCTLVRLGEDNYKFIWSHHHILMDGWCLSIIFKEILIFYKAHLLGENCQLPK
PRPYQDYIAWLNSQDKSAAIEFWQQTLQGFSAPTPLVMDKTQFLKEQQYKTADYQERTSS
LSPECTQKLLHIAQQHHVTLSTVVQAAWALLLSRYSGEKDVVFGVTVSGRPPSLSEIENM
VGLFINTLPLRVQVSTQEQLIPWLQKIQQSMVELQEYFYTPLVDIQATSEIPGGIPLFES
IVVFENYPIDNSLLNEEGSLHLGDIEVFEQTNYPLTLVAVPGDKLSVRISYDTARFSSNT
IEWILGYLQTVLSAIAIVENPSHKVAQLPLLSEVERHQLLVEWNNTATDYPSDKCIHQLF
EQQVEKNPNSIAVVFEEEQSTYQQLNQKANQLAHYLQTLGVKPEVLVGICIEYSIDMIVG
LLGILKAGGVYVPLDPNYPQERLAFMQEDSNVHIILTQQPLLEKISPQNAHIVCLDRDRD
VIAREGVENLDRQTTLDDLAYAIYTSGSTGKPKAVLGTLRGIVNRLHWIWEMLPFGADEI
CSQKTSINFGDHVAEIFSPLLKGIPLVIVPDDIRGNIPRLMSLLSDRKVTRIVLVPSLLK
AILENAPQQLTKLRYLKYVFCSGEVLPLTLAKEFHQKISSARLFNLYGSSEVAADVTCFE
VKLRIANQIEAKSKEKLDALKNLPSGSGDRETAVLHKEIIHLQLADERRADLGEALEEYL
KRNTIPIGKPISNTQIYILDKYGDLLPPGVTGELYVGGDGLAKGYLNLPELTREKFIPNP
FVKDRGKSKKAQAERLFRTGDLARWLPDGNIEFVGRIDHQVKVRGFRIELGEIEAVLSTH
PQIQQVVVIAIEDIPGSKRLVAYIVCEDESLSTYHLREFLKQKLPEYMMPSAFVILDTLP
LTPSGKIDRKALPAPDGEISREHEYVPPRTSGEEIIANIFASILGVQNVGIHDNFFELGG
HSLLATRLISRLRVAFEVEIELSAVFSSPTVAQLEQTLTQLRTTNSALSLPPIQPRTQNQ
QLPLSFAQDRLWFLNQLEGSSATYNMPGAIRVTGKLDINALQQALSEIVRRHEVLRTSFR
TVNGTPIQVIHPEATMNISVADLQQLEATERESVLHQQAQLAAITPFDLETAPLIRCSLL
QLDAREYVLLLTMHHIVSDGWSMGIFSQELSTLYQAFSAGKPSPLAELPIQYADFAVWQR
QWLSGKVLETQLNYWLSQLEGAPELLQLPTDRPRPTVQTFRGTTQSFSLNTDLKEKLQTL
SRNSGTTLFMTLHAAFATLLYRYSGQLDILIGSPIANRNCSEIESLIGFFANTLVLKTRF
EDNPSFENLLAQVRETTLEAYEHQDVPFEQVVEVLQPQRSLSYAPLFQVMFVLQNAPMGE
LELPGVTLNLLSSQTETARFDLTVSMQQTSEALVGSWEYNTDLFDGSTIERMTAHFQNLC
SAIVENPQQKISELPLFTDSEQEQVLHSYNNIATTYLLDKYVHFLSSNNLQIYILDNHQQ
LVPLSVEGEIYLGNCDLLPDKLHPEPEKFISFIEHTQLGKLLKTGEWGCRRVDGSLELLG
KEHRIVTVNGQRINLQRIEQALQTAKGVEDCYVMVRNQKLVAYVVKDGSWAREFLHHYLK
SQLPGYPLPCIYVPVSALPLTSFGEVDEVGLASISIIDSELINTWEEQIGSQAEIDKVAV
FIEPNVKTISPIHLEELLPSIQAIFNQGSTPVETPRTARGKESSSLLEIKSPAISHEEVL
IFPESSPETLGEMLQKTAGKFPHKGITYINSDGSEQVQSYAQLLEDAQRILGGFRKLGIK
PQDKVILQLKENKDFISAFWGCVLGGFIPVPVVIPVSYDQPNVNLNKLQNSWQMLERPLI
LTDKKSLSELKKWSQNLNDDNFKLETIESLQKFSTDKDYYNAQPEDLALFMLTSGSTGMS
KVVQLSHLNLLSRTIGSIQMNNFTPEDITLNWMPLDHVAGLIYFHIRDIYLGCKQIHATS
QLVIEKPLRWLDWIDTFGVTVTFAPNFAYSLINDFVQEIEKQNWNLSSIRLMLNGAEQIV
AATARRFLKLLAPFGLPGDAMTPSWGMAEVSSGITYSDNFSLLSSSDDNSFVNLGKPIRG
TCLRIVNQDMEVLSEGEIGLLQVKGLTVTSGYYQNPKANKEAFTEDGWFNTGDLGFIKDG
CLTITGRQKDIIIINGVNYYSHEIEAVVEELGEVEVSYTAACGVCVASNNTEELVIFFTP
YVSEKNQLLELLKKVREQVIKYCGINPSYLIPIDKELIPKTSIGKIQRSLLKQRFECGEF
KSLRQRVDLLLDNTNTIPNWFYRKVWQIKESKNTLLNYSSQKTLTLIFTDNLGWQQDNRG
MSQTVQPYAQVTIGSNFAQISPNHYSVVPGNPQHYRLLIDSLRQNSQVISQILHLWNYNE
QTEKISSLENLESTQQQGIYSLLFLVQALEEIQGKQQAVKLLWIANQSQLVHPTDKIQPE
KSTVLGLLKTVSQEMPWLTTRHLDLPLAPELNNSYIWQELYSADKELEVAIRNRERFVSG
LEPVDMTAKEKQKIPILPGGTYLLTGGLGGIGTVIAKYLLEHYQANLILVGRTQIEDNNE
EASTKLQRYQELEKLPGSIIYQTVDICDLVGLQQVVEKATQEWRTQLDGVFHMAGIIQET
PIEKETPGNIAAVLRPKVSGTWVLHQLLKDKENALFVHFCSVNGFFGGTNVAAYSAANSF
QSAWSDYQQQNGFQSYCCSWSMWNETGISHGYQFQELSRAKGYFIITPQQGFYSFLAALS
GSEHNLLIGLDGTKTNVEHLIRDCQPKQKLTAYFTSPTPELAALSLQELQLHDRFGIPNQ
INFVQLEQIPLTQRGEINREQIAAIYGGLNTSEQTKPRNQTERQLVEIFQEVLNLPSIGI
HDNFFSLGGHSLLAVRLMSEIQQQFQKNLPLATLFQNPTIERLALLVGSDSGAELWSPLV
PIQQNGSLPPLFCVPGAGGNVLYFHHLAQYLGNNQPLYGLQAQGLDGETEPHKSVEEIAS
QHIKAIQTVQPVGPYFLAGHSFGSHVVFEMANQLQLIGKSVAYVGILDTPAPTSQANHQN
DFSNWDNAKWICRMAEVIEDIVGENLFLSYETLTSLTWEQQLNYFKQKLEIVGFLPAQTD
IKIVRGLLQVFQTQCQIKYEPEKTYKTPITLFCAREINPEQESYSHIFQEPTWGWNQFSD
GEVEIHIVPGNHVSMLSEPHVKVLAQQMQISLEQAQKTHQLEK
selected fasta
>non-ribosomal peptide synthetase [CrpD]
ATGAGCAACGAAGAAATTAGAAGAAATATCTCTTCAATTTATCCACTTTCTCCCATGCAA
CAAGGGATGCTGTTCCACAGTCTTTATGCACCTTATAGTGGGGTATATCTTGAACAGATG
ACCTGGGGTTTGAAGGGGAATATCAATGTTGCTGCTTTTGAAAGAGCTTGGCAAAAAGTT
TTAGATAGACATTCAATTCTACGTACATTTTTTGTTTGGGAAAATCGCCAAACTCCATTA
CAAGTAGTACTAAAACAGGTTAATGTTCCTTGGAATACTCTTGATTGGCGAGAACTTTCT
TCTAATGATCAACAACAACAATTAAAACAATTATTGCAAACACAAAGAGAACAAGGTTTT
AACTTATCCCAAGCACCATTAATGCGGTGTACGTTAGTCAGGCTAGGCGAAGATAATTAC
AAATTTATCTGGAGTCATCACCACATCCTTATGGATGGATGGTGTTTATCAATTATTTTT
AAAGAAATTTTAATTTTCTATAAAGCACATCTGCTTGGTGAAAATTGCCAATTGCCAAAA
CCACGTCCTTACCAGGATTATATTGCTTGGTTGAATTCTCAAGACAAATCAGCAGCAATT
GAGTTTTGGCAACAAACTTTACAAGGTTTTAGTGCTCCCACTCCATTGGTAATGGATAAA
ACTCAATTTCTGAAAGAGCAACAGTATAAAACTGCGGATTATCAGGAGAGAACAAGTAGT
TTATCCCCTGAATGCACTCAGAAGTTACTTCATATAGCACAACAACATCATGTGACTTTA
TCAACTGTAGTACAAGCTGCTTGGGCTTTACTATTGAGTCGTTATAGTGGTGAGAAAGAT
GTAGTATTTGGTGTGACTGTTTCTGGTCGTCCTCCTAGCCTCTCTGAGATAGAAAATATG
GTAGGACTGTTTATTAACACCCTTCCCTTACGAGTACAAGTATCCACCCAGGAGCAACTC
ATACCTTGGTTGCAAAAAATACAACAGTCAATGGTTGAATTACAAGAGTATTTTTATACT
CCTCTTGTTGATATTCAAGCTACTTCTGAGATACCAGGTGGAATACCTTTGTTTGAGAGC
ATTGTGGTGTTTGAGAATTATCCAATTGATAATTCTTTGTTGAATGAAGAAGGTTCATTA
CACTTAGGTGATATAGAGGTTTTTGAACAAACTAATTATCCACTAACTTTAGTTGCAGTT
CCTGGGGATAAGTTGTCAGTTAGGATTAGTTACGATACTGCTCGTTTCTCTTCAAATACT
ATTGAGTGGATTTTAGGATATCTGCAAACTGTTTTATCAGCAATTGCAATTGTGGAAAAT
CCTTCACATAAGGTAGCTCAATTACCTTTATTAAGTGAAGTAGAACGTCATCAGTTATTG
GTTGAGTGGAATAACACTGCAACGGATTACCCATCTGATAAATGTATTCATCAGTTATTT
GAGCAACAGGTAGAAAAAAACCCCAACTCCATAGCAGTGGTGTTTGAAGAAGAACAATCA
ACCTACCAACAATTAAATCAAAAAGCGAACCAATTAGCACATTATCTACAAACTCTGGGA
GTGAAACCAGAAGTGCTGGTGGGTATTTGCATAGAATACTCCATTGATATGATTGTAGGA
CTGTTGGGGATACTTAAAGCTGGTGGTGTATATGTGCCGTTAGATCCGAACTATCCGCAA
GAACGACTGGCGTTCATGCAGGAAGATTCCAATGTGCATATCATATTGACCCAGCAGCCT
CTGCTCGAAAAGATTTCCCCTCAAAATGCCCATATCGTTTGCCTGGACAGGGATAGGGAT
GTCATTGCTAGGGAAGGCGTTGAAAATCTGGATCGGCAAACAACACTGGATGACCTTGCA
TACGCAATCTATACGTCTGGTTCTACTGGAAAACCCAAAGCCGTTCTCGGCACGCTTCGC
GGCATTGTCAATCGCTTGCATTGGATCTGGGAAATGCTACCATTTGGGGCAGATGAGATT
TGCTCTCAGAAAACATCCATCAATTTTGGCGATCATGTTGCGGAAATATTTTCTCCCCTT
CTCAAAGGAATTCCCCTTGTGATCGTTCCAGATGATATACGGGGCAATATTCCCAGGCTA
ATGAGCCTGTTGAGCGATCGAAAGGTAACTAGAATTGTTCTCGTTCCATCGCTATTAAAA
GCGATACTGGAAAATGCGCCCCAACAACTGACAAAACTTCGATATCTCAAATATGTCTTT
TGCAGCGGTGAAGTCTTACCGCTAACCTTGGCTAAGGAATTTCACCAGAAAATCAGCTCT
GCCAGATTGTTCAATCTCTACGGCTCTTCAGAAGTTGCCGCTGATGTTACATGCTTTGAA
GTCAAACTGAGAATCGCAAATCAAATTGAAGCAAAAAGTAAAGAGAAACTTGATGCTTTA
AAAAATCTTCCTAGTGGCTCAGGGGATAGGGAAACTGCTGTCCTGCATAAAGAAATAATA
CATTTGCAGTTGGCAGACGAGCGAAGAGCAGATTTAGGAGAAGCTCTAGAAGAATATCTG
AAAAGAAATACGATTCCGATTGGAAAACCGATTTCAAACACACAAATTTACATCCTCGAC
AAGTATGGCGATCTTTTGCCACCTGGTGTTACGGGTGAGCTATACGTCGGCGGAGATGGG
CTTGCAAAAGGGTATTTAAATCTGCCCGAGTTAACGCGGGAAAAGTTTATCCCCAACCCG
TTTGTGAAGGACAGGGGGAAAAGTAAAAAGGCACAAGCAGAAAGATTGTTTAGGACTGGA
GACCTAGCCCGCTGGCTGCCGGATGGTAATATCGAATTTGTAGGGCGTATCGATCACCAA
GTGAAGGTGCGGGGCTTCCGCATTGAACTTGGAGAAATCGAAGCAGTCCTCAGTACCCAC
CCCCAAATCCAACAAGTCGTTGTCATTGCCATAGAAGATATTCCAGGTAGCAAACGTTTA
GTAGCCTACATAGTCTGTGAGGATGAATCACTAAGTACCTATCACCTGCGTGAATTCCTC
AAACAAAAGCTACCAGAATACATGATGCCCAGTGCCTTTGTCATCTTAGACACCTTACCG
TTGACACCCAGCGGTAAAATAGACCGTAAAGCCCTTCCAGCACCTGATGGAGAAATTAGC
CGAGAACATGAATATGTCCCACCACGTACATCGGGTGAAGAAATAATAGCCAACATCTTC
GCTTCTATTCTAGGTGTGCAAAATGTTGGAATCCATGACAACTTCTTTGAATTGGGAGGA
CATTCCCTACTAGCAACCCGATTAATTTCCCGACTCAGAGTTGCCTTTGAAGTAGAAATA
GAACTAAGTGCAGTCTTTTCCTCTCCCACTGTAGCTCAATTAGAGCAAACATTAACCCAA
TTACGTACTACTAATAGCGCATTAAGTCTTCCCCCCATTCAGCCAAGAACACAGAACCAA
CAATTACCCCTATCTTTTGCACAAGACCGGTTGTGGTTCCTCAACCAACTTGAAGGGTCA
AGTGCCACTTATAACATGCCAGGAGCAATTCGTGTCACTGGAAAGTTGGATATTAATGCC
TTGCAACAAGCATTATCAGAAATAGTCCGCCGTCATGAAGTACTACGCACCAGCTTCCGA
ACTGTGAATGGCACACCAATACAGGTAATTCACCCAGAAGCCACCATGAACATCAGTGTG
GCGGACTTACAGCAACTAGAAGCAACAGAACGGGAAAGTGTCCTTCACCAACAAGCACAA
CTTGCAGCAATTACCCCCTTTGACTTAGAAACTGCACCACTAATCAGGTGTAGTTTATTG
CAGTTAGATGCCAGAGAATATGTGTTATTACTGACGATGCACCACATTGTCTCTGATGGT
TGGTCAATGGGGATATTCAGCCAAGAACTATCTACTTTATATCAAGCTTTTAGTGCAGGA
AAACCATCCCCCTTGGCAGAATTACCAATCCAGTATGCAGACTTTGCAGTTTGGCAAAGA
CAATGGTTAAGTGGAAAGGTACTAGAAACTCAACTCAATTACTGGCTTTCTCAGTTAGAG
GGTGCACCAGAATTGTTACAATTACCTACTGACCGTCCTCGTCCAACCGTGCAAACTTTC
CGGGGTACTACTCAAAGTTTTAGTTTAAATACTGATTTAAAAGAGAAGTTGCAAACCCTG
TCTCGGAACTCGGGTACTACCTTATTTATGACCCTGCACGCAGCGTTTGCCACTTTACTC
TATCGCTACAGCGGTCAATTAGATATTTTAATTGGTTCACCCATTGCCAATCGCAACTGC
AGTGAAATTGAGTCTTTGATTGGCTTTTTTGCCAATACTTTGGTATTGAAAACCCGTTTT
GAAGATAATCCCAGTTTTGAGAATTTGCTGGCACAAGTTAGGGAAACTACACTTGAAGCT
TATGAACATCAGGATGTGCCTTTTGAACAGGTAGTTGAAGTACTACAACCACAACGCTCT
TTGAGTTATGCACCCTTATTCCAGGTAATGTTTGTGTTGCAGAATGCACCCATGGGTGAA
TTAGAATTACCTGGTGTGACCCTTAATTTATTGAGTTCTCAAACAGAAACAGCCCGGTTT
GATTTAACAGTATCAATGCAGCAAACTTCCGAAGCACTAGTGGGTTCATGGGAATACAAC
ACTGACTTATTTGATGGGTCAACTATTGAGCGCATGACTGCTCATTTCCAGAATCTGTGT
AGCGCGATTGTAGAAAATCCCCAACAAAAGATAAGTGAATTACCATTATTCACAGATTCT
GAGCAAGAGCAGGTACTGCACAGTTACAATAACATCGCTACAACTTACCTGCTGGATAAA
TATGTTCATTTCCTGAGTTCAAATAATTTACAAATTTACATTTTAGATAACCATCAACAA
TTAGTTCCTTTGAGTGTAGAAGGAGAAATTTATTTGGGGAATTGCGATTTACTCCCAGAC
AAGTTACATCCAGAACCAGAAAAATTTATAAGTTTCATAGAACATACCCAACTGGGTAAG
TTATTAAAAACAGGGGAATGGGGTTGTCGTCGAGTCGATGGTTCTCTGGAATTGCTAGGA
AAAGAGCATCGAATTGTCACAGTTAATGGACAACGAATTAACCTACAACGTATTGAACAA
GCTTTACAAACAGCGAAAGGGGTAGAAGATTGCTATGTAATGGTACGCAATCAAAAATTA
GTCGCTTACGTAGTCAAAGATGGTTCTTGGGCTAGGGAGTTTTTACACCATTATTTAAAA
TCTCAGTTACCTGGATACCCATTACCCTGCATCTATGTACCAGTATCTGCTTTACCATTG
ACAAGTTTTGGAGAAGTTGATGAAGTAGGTTTAGCTTCTATTAGCATAATTGATTCTGAG
TTAATTAACACTTGGGAAGAACAAATAGGTTCTCAGGCGGAAATTGATAAAGTTGCTGTT
TTTATTGAGCCAAATGTAAAAACGATTTCTCCGATACATTTAGAAGAACTTTTACCATCA
ATCCAAGCTATTTTCAATCAAGGTTCTACTCCAGTTGAAACTCCCAGAACTGCTAGGGGA
AAAGAGAGTAGTTCCCTATTAGAAATAAAATCACCTGCCATCAGCCACGAAGAAGTATTA
ATCTTTCCAGAATCATCTCCAGAAACTTTAGGGGAGATGCTGCAAAAAACTGCTGGGAAA
TTTCCTCACAAAGGAATCACTTATATTAACTCTGATGGTTCCGAACAAGTTCAATCATAT
GCCCAGTTATTAGAAGATGCTCAAAGAATTCTAGGTGGCTTCAGAAAACTGGGAATTAAG
CCACAAGATAAAGTTATTTTGCAATTAAAAGAAAATAAAGATTTTATTAGTGCTTTTTGG
GGTTGTGTGTTGGGAGGCTTTATTCCCGTACCCGTTGTAATTCCTGTAAGCTATGACCAG
CCCAATGTCAATCTAAATAAATTACAAAATAGTTGGCAGATGTTAGAAAGACCTTTGATT
TTAACAGATAAAAAATCATTGTCAGAACTAAAGAAATGGTCTCAAAATCTAAATGACGAC
AACTTTAAGTTAGAAACTATTGAAAGTTTACAAAAGTTCTCAACAGATAAAGATTACTAT
AATGCCCAACCAGAAGATTTAGCACTGTTCATGCTTACTTCCGGTAGTACAGGTATGTCT
AAGGTGGTACAGTTGAGCCATTTAAATCTACTGAGTAGGACTATTGGTTCAATACAAATG
AATAATTTTACCCCAGAAGATATAACCTTAAATTGGATGCCCTTAGACCATGTTGCAGGT
TTAATATATTTTCATATCCGGGATATTTATTTAGGATGTAAACAAATTCATGCTACTAGT
CAATTAGTGATTGAAAAACCTTTAAGATGGTTGGATTGGATTGATACTTTTGGTGTCACT
GTTACTTTTGCTCCTAACTTTGCTTATAGTTTAATTAATGATTTTGTTCAAGAAATAGAA
AAGCAGAATTGGAATTTATCTTCTATTCGCTTGATGTTAAATGGTGCGGAACAAATTGTT
GCAGCAACAGCAAGACGTTTTTTGAAATTACTTGCTCCCTTTGGCTTACCTGGGGATGCT
ATGACTCCATCTTGGGGAATGGCTGAGGTTTCCTCTGGTATTACTTATTCTGACAATTTT
TCACTCTTATCAAGTTCAGATGATAATTCCTTTGTAAATCTTGGAAAACCGATTAGGGGT
ACTTGTCTGAGAATAGTCAATCAAGACATGGAAGTATTATCAGAAGGTGAAATTGGTTTA
CTTCAGGTCAAAGGATTAACCGTTACTTCTGGTTATTATCAAAATCCAAAAGCAAATAAG
GAAGCATTTACCGAAGATGGTTGGTTTAATACAGGTGATTTAGGATTTATAAAAGATGGA
TGCTTAACGATTACAGGACGACAAAAAGATATCATTATTATTAATGGAGTTAATTATTAT
AGTCATGAAATAGAAGCTGTTGTTGAAGAATTAGGAGAGGTTGAAGTTTCTTATACCGCA
GCCTGTGGAGTCTGCGTTGCTAGCAATAATACCGAAGAATTAGTAATCTTTTTCACTCCG
TATGTATCTGAGAAGAATCAATTATTAGAGCTTTTGAAAAAGGTTAGGGAACAAGTTATA
AAATACTGCGGGATAAATCCAAGTTATTTAATACCCATAGATAAAGAACTGATTCCCAAA
ACTTCCATCGGTAAAATTCAACGTTCCCTCCTTAAGCAACGTTTTGAATGTGGTGAGTTT
AAATCTCTCAGACAGCGTGTAGACTTGTTGCTTGATAATACTAATACTATTCCCAACTGG
TTTTACCGTAAAGTATGGCAAATTAAAGAAAGTAAAAATACTTTACTCAATTATTCTTCT
CAGAAAACTTTAACCCTAATATTTACAGATAATTTGGGTTGGCAACAAGATAACCGAGGA
ATGTCCCAAACTGTTCAACCATATGCTCAAGTTACTATTGGTTCAAATTTTGCTCAAATT
AGCCCAAATCATTATTCTGTTGTTCCTGGAAATCCACAACACTATCGCTTGTTAATTGAT
TCTTTGAGGCAAAATAGCCAAGTAATTAGTCAAATTCTTCATCTTTGGAACTACAACGAG
CAGACTGAAAAAATTTCTAGCTTGGAAAATTTAGAGTCCACTCAACAACAAGGAATTTAC
AGTTTACTATTTTTAGTACAAGCTTTAGAAGAAATTCAAGGCAAACAGCAAGCAGTCAAA
TTATTATGGATTGCTAATCAAAGCCAATTAGTTCATCCCACAGATAAAATTCAACCCGAA
AAATCCACTGTTTTAGGCTTACTTAAAACTGTTAGTCAAGAAATGCCTTGGTTAACTACT
CGTCATTTAGATTTACCATTAGCACCAGAACTCAACAATAGTTATATTTGGCAAGAACTG
TATTCTGCTGATAAAGAATTGGAAGTTGCTATACGCAATAGAGAACGTTTTGTGTCTGGT
CTGGAACCAGTAGATATGACTGCTAAGGAAAAACAAAAAATTCCGATTCTACCAGGAGGA
ACGTATCTACTTACAGGAGGGCTTGGAGGAATTGGGACTGTTATTGCAAAGTACTTATTA
GAACATTATCAAGCAAATTTAATATTAGTTGGTAGAACTCAAATTGAAGATAATAATGAG
GAAGCTAGCACAAAATTGCAGAGGTATCAAGAATTAGAAAAACTACCAGGTTCAATAATT
TATCAAACTGTAGATATTTGTGATTTAGTAGGTTTACAACAGGTAGTAGAAAAAGCAACA
CAAGAATGGAGGACTCAACTTGATGGGGTATTTCATATGGCTGGGATTATTCAGGAAACG
CCAATCGAGAAAGAAACCCCAGGAAATATCGCTGCTGTTTTACGTCCTAAAGTTAGCGGT
ACTTGGGTATTGCATCAATTGCTCAAGGATAAAGAAAATGCTTTATTTGTCCACTTTTGT
TCTGTAAATGGTTTCTTTGGAGGAACCAATGTTGCAGCTTATAGTGCAGCAAATAGTTTT
CAGTCAGCATGGAGCGATTATCAACAACAAAACGGTTTCCAAAGCTATTGCTGCTCTTGG
AGTATGTGGAATGAAACCGGAATAAGTCATGGCTATCAATTCCAAGAACTCAGTCGTGCT
AAGGGCTATTTTATTATTACTCCTCAACAAGGATTTTACTCATTTTTAGCAGCTTTATCT
GGTTCGGAACATAATCTATTAATCGGATTGGATGGAACTAAAACAAATGTTGAACATTTG
ATTCGTGATTGTCAGCCCAAGCAGAAATTAACTGCTTACTTCACCTCTCCCACACCAGAA
CTTGCTGCACTCTCCTTACAAGAGTTACAACTACACGATCGCTTTGGGATACCCAATCAA
ATTAACTTTGTCCAACTTGAACAAATACCCCTTACTCAAAGAGGAGAAATTAATCGGGAA
CAAATTGCTGCTATATATGGAGGTTTGAATACTTCTGAGCAGACAAAACCACGGAATCAA
ACAGAACGTCAGTTAGTTGAGATTTTCCAAGAAGTTCTCAATCTACCCTCTATTGGTATT
CATGACAACTTCTTTAGCTTAGGAGGACATTCCCTTCTAGCTGTCCGTCTAATGTCCGAG
ATTCAACAACAATTCCAGAAAAATTTACCTTTAGCCACTCTTTTTCAAAATCCCACCATT
GAACGACTAGCACTTCTTGTTGGTTCCGATTCCGGAGCCGAACTTTGGTCTCCATTAGTA
CCAATTCAACAAAACGGTTCATTACCACCTTTGTTCTGTGTACCAGGAGCAGGTGGAAAT
GTTCTCTACTTCCACCACTTAGCACAATATCTTGGAAATAATCAACCGTTATACGGTTTA
CAAGCACAAGGTCTTGATGGTGAAACCGAACCTCATAAAAGTGTTGAAGAAATAGCCTCC
CAACACATTAAAGCAATTCAAACAGTTCAACCAGTTGGTCCTTACTTCTTGGCTGGTCAT
TCCTTTGGCAGTCATGTAGTATTTGAAATGGCGAATCAACTACAACTTATTGGAAAGTCT
GTTGCTTATGTTGGAATTTTAGATACTCCTGCACCAACTTCTCAAGCTAATCATCAGAAT
GATTTTTCTAACTGGGATAATGCAAAGTGGATATGTCGAATGGCTGAGGTTATTGAAGAT
ATTGTTGGAGAAAATCTATTTTTATCTTATGAAACTCTAACTTCTCTAACTTGGGAGCAA
CAATTAAATTATTTCAAGCAAAAGTTAGAAATAGTTGGTTTTTTGCCTGCTCAAACAGAT
ATCAAAATTGTTCGTGGTTTATTACAAGTTTTCCAAACTCAATGTCAAATTAAGTATGAA
CCGGAAAAGACTTATAAAACTCCAATCACTTTGTTTTGTGCGAGGGAGATAAATCCAGAG
CAAGAAAGTTATTCTCACATTTTCCAAGAGCCAACATGGGGTTGGAATCAGTTTTCTGAT
GGAGAAGTGGAAATCCATATAGTTCCGGGTAATCATGTTTCAATGCTGAGTGAGCCTCAT
GTCAAGGTATTGGCTCAACAAATGCAAATATCTCTTGAACAAGCACAGAAAACCCATCAA
TTGGAAAAATGA
[5] C12..314
[5] A501..968
[5] alpha-methyl-beta-alanine670..775
[5] PCP1052..1119
[6] C1139..1440
[6] A1899..2315
[6] 2-keto-isocaproic acid2078..2193
[6] KR2660..2846
[6] PCP2981..3048
[6] TE3069..3321
[5] C34..942
[5] A1501..2904
[5] alpha-methyl-beta-alanine2008..2325
[5] PCP3154..3357
[6] C3415..4320
[6] A5695..6945
[6] 2-keto-isocaproic acid6232..6579
[6] KR7978..8538
[6] PCP8941..9144
[6] TE9205..9963

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [501-968]  9.80000000000012e-114 PF00501 [1609-1713]  4.80000000000001e-12 PF00501 [1899-2315]  1.10000000000001e-84 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [3069-3321]  2.6e-31 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [12-314]  1.39999999999997e-79 PF00668 [1139-1440]  1.10000000000001e-82 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1077-1092]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1052-1119]  PS50075 [2981-3048]  PS50075
PS50075   ACP_DOMAIN
 [1045-1156]  5.79999653854781e-24 SSF47336 [2974-3049]  7.30000590915208e-20 SSF47336
SSF47336   ACP_like
 [1056-1117]  2e-13 PF00550 [2983-3045]  7.59999999999999e-16 PF00550
PF00550   PP-binding
 [1042-1122]  6.19999999999994e-54 G3DSA:1.10.1200.10 [2971-3049]  6.19999999999994e-54 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [2660-2845]  8.39999999999997e-45 PF08659
PF08659   KR
IPR016040 NAD(P)-binding domain (Domain)
 [2658-2880]  1.2e-31 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2660-2846]  5.29999657550189e-32 SM00822
SM00822   PKS_KR
IPR020845 AMP-binding, conserved site (Conserved_site)
 [2030-2041]  PS00455
PS00455   AMP_BINDING
IPR023213 Chloramphenicol acetyltransferase-like domain (Domain)
 [1133-1302]  3.9e-05 G3DSA:3.30.559.10
G3DSA:3.30.559.10   CAT-like_dom
SignalP No significant hit
TMHMM No significant hit