close all open/close all

CDS information : Crypto_00050


close this sectionLocation

Organism
StrainATCC 53789
Entry nameCryptophycin 1
Contig
Start / Stop / Direction45,180 / 46,532 / + [in whole cluster]
45,180 / 46,532 / + [in contig]
Location45180..46532 [in whole cluster]
45180..46532 [in contig]
TypeCDS
Length1,353 bp (450 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productepoxidase
cytochrome P450
Product (GenBank)CrpE
Gene
Gene (GenBank)crpE
EC number
Keyword
Note
Note (GenBank)
  • CYP450 responsible for epoxidation of cryptophycins
Reference
ACC
PmId
[17240975] Biosynthetic characterization and chemoenzymatic assembly of the cryptophycins. Potent anticancer agents from cyanobionts. (ACS Chem Biol. , 2006)
[17240971] Cryptophycin anticancer drugs revisited. (ACS Chem Biol. , 2006)
[18366166] Analysis of the cryptophycin P450 epoxidase reveals substrate tolerance and cooperativity. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>epoxidase [CrpE]
MINTAKSSLLPGPTTPSWWNLLQWLNNPCEFLEECRARYGDTFTFKAIGFEPLVLISNPK
DIKEIFDKHKYFDSGKAKANDLAGFFLGNNSVTLLDGSSHKRQRKLLMPAFHGQNISNYG
ELICHATKQVTSNWQPGQRLIIYKEVKEITLRAMLTVLLGSDKTERYQQLKLIVNQIVST
ITNPFASSSLFFNVFRRDWGSWSAWGNLLRCQRQIANIISAEIKERRENCNNYNNDILSM
LMAARDENGGKMTDEELQDELMTLIFSGYETTSAAITWAYYWIHYLPEIRAKLLQELDEL
GDNPDPTEISKLPYLNAVCAETLRIYPVGLTTFPRIVKSPIEIGGHQFEVGTCLYPCIYL
IHHREELYPNSKQFKPERFLDNKFLNYEYFPFGGGNRTCIGMAFAQFKMKLVLANILRNW
QLELVGKPPLKPVRDIFSIYPQGGLKMVVL
selected fasta
>epoxidase [CrpE]
ATGATTAATACTGCTAAATCCTCATTACTTCCTGGTCCCACTACACCATCTTGGTGGAAC
TTATTGCAATGGCTTAATAATCCTTGTGAATTTTTGGAAGAGTGTCGAGCACGCTATGGA
GACACTTTTACCTTCAAAGCTATTGGTTTTGAACCTTTAGTACTTATTAGTAATCCTAAG
GATATAAAAGAAATTTTTGATAAACACAAGTATTTTGACAGTGGAAAAGCTAAAGCTAAC
GATTTAGCAGGATTTTTTTTAGGCAACAATTCCGTCACCTTGCTTGATGGAAGTAGTCAT
AAACGACAGCGTAAACTACTGATGCCTGCTTTTCATGGTCAAAATATATCTAACTATGGA
GAACTAATATGCCATGCAACGAAGCAGGTTACTTCTAATTGGCAACCTGGTCAAAGATTG
ATTATTTACAAGGAAGTCAAAGAAATTACGCTGCGAGCGATGTTAACGGTTTTACTGGGT
TCAGATAAAACGGAACGTTATCAACAACTCAAATTGATAGTTAATCAAATAGTATCCACT
ATAACTAATCCCTTTGCTTCTAGCTCTCTTTTCTTCAATGTGTTTAGAAGAGACTGGGGT
TCTTGGAGTGCCTGGGGTAATCTTTTACGTTGCCAACGTCAGATTGCAAATATCATTTCT
GCAGAAATCAAAGAACGTAGAGAAAATTGTAACAATTACAACAATGATATCCTCAGTATG
CTGATGGCAGCACGAGATGAAAATGGAGGAAAAATGACAGATGAGGAGTTGCAAGATGAG
TTAATGACACTTATCTTTTCTGGATATGAAACTACATCTGCAGCAATAACATGGGCATAT
TATTGGATTCATTACTTACCAGAGATAAGAGCCAAGTTATTGCAAGAATTAGATGAGTTA
GGAGATAATCCAGACCCAACGGAAATAAGCAAATTACCTTATCTCAATGCAGTTTGTGCT
GAAACCTTGAGAATATATCCAGTTGGTCTAACTACTTTTCCTCGAATTGTAAAATCGCCA
ATAGAAATTGGAGGTCATCAATTTGAGGTAGGAACTTGTCTTTATCCATGTATTTATCTA
ATTCACCACCGGGAAGAACTATATCCTAACTCTAAACAGTTTAAGCCAGAACGTTTTCTA
GATAATAAATTTTTAAATTATGAGTATTTCCCTTTCGGTGGCGGTAACCGAACTTGCATT
GGTATGGCATTTGCTCAGTTTAAAATGAAGTTAGTATTGGCTAATATTTTGCGGAATTGG
CAATTGGAATTGGTAGGCAAACCTCCTTTAAAACCAGTACGAGATATTTTCTCAATTTAT
CCTCAAGGTGGATTAAAAATGGTTGTATTGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [10-449]  9.40003071030835e-101 SSF48264
SSF48264   Cytochrome_P450
 [267-284]  1.09999909120787e-11 PR00385 [317-328]  1.09999909120787e-11 PR00385 [390-399]  1.09999909120787e-11 PR00385 [399-410]  1.09999909120787e-11 PR00385
PR00385   P450
 [11-430]  1.10000000000001e-84 PF00067
PF00067   p450
 [14-448]  3.60000000000002e-103 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002401 Cytochrome P450, E-class, group I (Family)
 [36-55]  7.00000734129907e-24 PR00463 [256-273]  7.00000734129907e-24 PR00463 [276-302]  7.00000734129907e-24 PR00463 [316-334]  7.00000734129907e-24 PR00463 [357-381]  7.00000734129907e-24 PR00463 [389-399]  7.00000734129907e-24 PR00463 [399-422]  7.00000734129907e-24 PR00463
PR00463   EP450I
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [392-401]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-37]  0.203 Signal
Eukaryota   
TMHMM No significant hit