close all open/close all

CDS information : Crypto_00060


close this sectionLocation

Organism
StrainATCC 53789
Entry nameCryptophycin 1
Contig
Start / Stop / Direction46,916 / 47,800 / + [in whole cluster]
46,916 / 47,800 / + [in contig]
Location46916..47800 [in whole cluster]
46916..47800 [in contig]
TypeCDS
Length885 bp (294 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)CrpF
Gene
Gene (GenBank)crpF
EC number
Keyword
Note
Note (GenBank)
  • iron containing 2-oxoglutarate dependent oxygenase
Reference
ACC
PmId
[17240975] Biosynthetic characterization and chemoenzymatic assembly of the cryptophycins. Potent anticancer agents from cyanobionts. (ACS Chem Biol. , 2006)
[17240971] Cryptophycin anticancer drugs revisited. (ACS Chem Biol. , 2006)
Family/Domain
FD
IPR003819

close this sectionSequence

selected fasta
>putative oxidoreductase [CrpF]
MYSIKIENLIIRVKSVLEMPVSKEAEMANKFNEFGFVILEHEPSATPKNNLLKLSDYFGT
IIQHEHSDSQGIVPISPVDSYPEYVNTTTTDLSLHTDGAFTITPPKVMAMQCQIAAANGG
FTKLIDGKLVYEHLKRTNPVGLLTLFNPDAITVKRDNKKATKPIFEEHHAGLIVRFRADN
AAHVSVESKSFAAFKSFENFVNNPDNQVIFKLAQNQIIIVDNTRVLHGRTAFSKQEYRLL
NRLWFDGQSDIINLKFGISIAPKNLSLFAKKYQPSQIDIGSDISQSTQLKFKAT
selected fasta
>putative oxidoreductase [CrpF]
ATGTATTCAATAAAAATTGAAAATCTAATAATTAGAGTGAAAAGTGTATTAGAAATGCCA
GTTTCTAAAGAAGCTGAGATGGCAAATAAATTTAATGAGTTTGGATTCGTAATACTAGAA
CACGAACCTTCAGCAACACCTAAGAATAACTTATTAAAATTGTCTGATTATTTTGGAACA
ATTATTCAGCACGAACATTCTGATTCACAGGGAATTGTTCCCATCAGTCCTGTTGATAGT
TATCCAGAATATGTAAATACTACAACTACAGATTTATCGTTACATACGGATGGAGCGTTC
ACAATTACTCCACCAAAAGTAATGGCAATGCAGTGCCAGATTGCTGCTGCAAATGGCGGG
TTCACCAAGCTTATTGATGGCAAGCTGGTATATGAACATCTAAAGCGGACAAACCCAGTT
GGATTGTTAACTTTGTTTAATCCTGATGCGATTACAGTCAAAAGAGATAATAAAAAAGCA
ACTAAACCTATTTTTGAAGAACATCATGCTGGGCTTATTGTAAGGTTTAGAGCAGATAAT
GCAGCTCATGTTTCGGTTGAATCGAAAAGTTTTGCGGCATTTAAATCATTTGAAAACTTT
GTAAATAATCCTGACAATCAAGTAATTTTTAAACTTGCACAAAACCAAATAATTATTGTA
GATAATACTAGAGTTTTGCATGGAAGAACTGCATTTTCCAAACAAGAGTATAGGCTACTA
AATCGACTTTGGTTTGATGGACAATCTGATATTATAAATTTAAAGTTTGGTATTTCTATA
GCCCCAAAAAACTTGAGTTTATTTGCTAAAAAGTATCAGCCATCTCAAATAGATATAGGC
TCAGATATTTCTCAGTCAACTCAATTGAAATTTAAAGCCACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003819 Taurine catabolism dioxygenase TauD/TfdA (Family)
 [24-244]  1.5e-31 PF02668
PF02668   TauD
SignalP No significant hit
TMHMM No significant hit