close all open/close all

CDS information : Crypto_00070


close this sectionLocation

Organism
StrainATCC 53789
Entry nameCryptophycin 1
Contig
Start / Stop / Direction47,812 / 48,153 / + [in whole cluster]
47,812 / 48,153 / + [in contig]
Location47812..48153 [in whole cluster]
47812..48153 [in contig]
TypeCDS
Length342 bp (113 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Product3-methylaspartate 1-decarboxylase
Product (GenBank)CrpG
Gene
Gene (GenBank)crpG
EC number4.1.1.-
Keyword
  • alpha-methyl-beta-alanine
Note
Note (GenBank)
  • decarboxylase
Reference
ACC
PmId
[17240975] Biosynthetic characterization and chemoenzymatic assembly of the cryptophycins. Potent anticancer agents from cyanobionts. (ACS Chem Biol. , 2006)
[17240971] Cryptophycin anticancer drugs revisited. (ACS Chem Biol. , 2006)
[17600793] Characterization of the beta-methylaspartate-alpha-decarboxylase (CrpG) from the cryptophycin biosynthetic pathway. (Chembiochem. , 2007)

close this sectionSequence

selected fasta
>3-methylaspartate 1-decarboxylase [CrpG]
MRIMLKSKIHRATVTEANVNYIGSITVDKVLMEKADILPGEKVMVVDNTNGNRLETYVLE
GEENSGVICMNGGSAHLVNSGDLITLLAFEVTDEIKEPKKIIVDENNKFLKYL
selected fasta
>3-methylaspartate 1-decarboxylase [CrpG]
ATGCGTATTATGTTGAAGTCGAAAATTCACAGAGCGACGGTGACGGAAGCCAACGTTAAC
TACATCGGAAGTATTACAGTAGACAAAGTTCTGATGGAAAAGGCAGACATACTACCGGGT
GAAAAGGTTATGGTGGTGGACAACACTAATGGTAATCGTCTAGAAACCTATGTCCTAGAA
GGTGAGGAAAATTCCGGGGTAATCTGTATGAACGGTGGCTCCGCCCACCTAGTCAATTCA
GGAGACCTTATCACATTGCTAGCATTCGAGGTAACTGACGAAATCAAGGAACCGAAAAAA
ATTATCGTGGATGAAAACAACAAGTTTCTCAAGTACCTGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003190 Aspartate decarboxylase (Family)
 [1-109]  3.59998852907783e-45 PIRSF006246
PIRSF006246   Asp_decarbox
 [4-89]  PD009294
PD009294   Asp_decarbox
 [2-111]  2.59999999999998e-36 TIGR00223
TIGR00223   PanD
 [2-109]  1.2e-41 PF02261
PF02261   Asp_decarbox
IPR009010 Aspartate decarboxylase-like fold (Domain)
 [1-113]  2.80000504261099e-37 SSF50692
SSF50692   Asp_decarb_fold
 [2-111]  5.49999999999995e-43 G3DSA:2.40.40.20
G3DSA:2.40.40.20   Asp_decarboxylase-like_fold
SignalP No significant hit
TMHMM No significant hit