close all open/close all
Crypto_00070 Crypto_00070   last last

CDS information : Crypto_00080


close this sectionLocation

Organism
StrainATCC 53789
Entry nameCryptophycin 1
Contig
Start / Stop / Direction48,796 / 50,271 / + [in whole cluster]
48,796 / 50,271 / + [in contig]
Location48796..50271 [in whole cluster]
48796..50271 [in contig]
TypeCDS
Length1,476 bp (491 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative halogenase
Product (GenBank)CrpH
Gene
Gene (GenBank)crpH
EC number
Keyword
Note
Note (GenBank)
  • halogenase
Reference
ACC
PmId
[17240975] Biosynthetic characterization and chemoenzymatic assembly of the cryptophycins. Potent anticancer agents from cyanobionts. (ACS Chem Biol. , 2006)
[17240971] Cryptophycin anticancer drugs revisited. (ACS Chem Biol. , 2006)
Related Reference
ACC
O87676
NITE
Balhi_00140
PmId
[11880037] Glycopeptide biosynthesis in Amycolatopsis mediterranei DSM5908: function of a halogenase and a haloperoxidase/perhydrolase. (Chem Biol. , 2002)
[15342578] Biosynthesis of chloro-beta-hydroxytyrosine, a nonproteinogenic amino acid of the peptidic backbone of glycopeptide antibiotics. (J Bacteriol. , 2004)

close this sectionSequence

selected fasta
>putative halogenase [CrpH]
MSTLPNSTQILIIGGGPSGSTAATLLAREGFDVTLLEREVFPRYHVGESLLPSALEIFDL
LGVREKIEAYGFQRKPGAYIEWGTEKWSLNFGELTGDNTYSFQVRRDEFDHLLLEHSKSQ
GVKVFEGTKIRQLSFDGDRPRSATWSQSNDTTGEISFDFMIDASGRAGIMATEYLKNRRL
HDVFQNVGIWGYWKNALRLPKGQSGAIALGSIPDGWVWGIPLDEEIMSVGVVMHKSTYKE
RLTKNLKDIYVEAIAECPLIADLVALGELVSDVKVEQDYSYTSDSFSGPAYFISGDAACF
LDPLLSSGVHLATYSALLAAASITSVIRGEVTESQAASFYDQSYRQAYLRFLVFVSAFYD
QNRGKDSYFWEAQRLSRRDFGSSNLKLAFLNLVSGVEDLEDAKEGIADFVMAEMSQRIQS
SHSIRQDKQALAIEREKGNEVMKTNAQFFNAVEGFSILSAVGAVDGLYVTTQPKLGLVQV
IPLQRNSLLHT
selected fasta
>putative halogenase [CrpH]
ATGTCTACACTGCCTAATTCCACACAGATTCTAATTATCGGAGGGGGACCTTCTGGATCT
ACTGCTGCTACCCTATTGGCTCGTGAGGGCTTTGATGTAACGCTGTTAGAACGAGAGGTA
TTCCCGCGTTACCACGTTGGGGAATCTCTTTTGCCCTCTGCTTTAGAAATTTTTGACCTG
CTTGGCGTACGCGAGAAAATTGAAGCTTATGGCTTTCAGCGTAAACCTGGAGCGTACATA
GAATGGGGAACGGAAAAGTGGAGCCTCAATTTTGGGGAACTTACGGGGGACAACACCTAC
AGCTTCCAAGTTCGCCGTGACGAATTCGACCACTTGCTTTTAGAGCATTCAAAGAGCCAG
GGTGTGAAGGTTTTTGAAGGGACTAAAATTCGCCAGTTGTCTTTTGATGGCGATCGCCCG
CGCAGCGCTACTTGGTCACAATCAAATGATACTACCGGGGAGATTTCTTTTGACTTTATG
ATTGACGCTTCAGGTCGTGCTGGGATCATGGCGACGGAGTATCTGAAAAACCGCCGTCTA
CACGACGTATTCCAGAATGTTGGCATCTGGGGGTACTGGAAAAACGCCTTGAGACTACCT
AAAGGTCAGTCGGGTGCGATTGCCTTGGGCTCCATTCCAGATGGTTGGGTGTGGGGAATT
CCTTTGGATGAGGAAATTATGAGCGTTGGTGTAGTGATGCATAAGTCAACCTACAAGGAG
AGACTGACTAAGAACTTGAAGGATATCTACGTGGAGGCGATTGCAGAGTGTCCCTTGATA
GCGGATCTGGTTGCACTAGGGGAGCTAGTCTCAGACGTGAAAGTTGAGCAAGATTACTCT
TACACTTCCGACTCCTTTTCAGGACCAGCCTACTTCATATCGGGAGACGCTGCTTGCTTC
CTAGACCCCCTACTATCGAGTGGGGTGCATCTTGCTACTTATAGCGCTTTGTTAGCCGCA
GCCAGTATCACAAGTGTTATACGTGGCGAGGTGACTGAGTCACAAGCTGCTTCTTTCTAC
GATCAGAGCTATCGGCAGGCTTATTTGCGTTTCTTAGTGTTCGTATCAGCCTTCTACGAT
CAAAACCGTGGCAAGGATTCCTATTTCTGGGAGGCACAACGGCTTAGTCGCCGTGACTTC
GGCAGTTCTAACCTAAAGCTAGCATTCTTGAATCTGGTGTCCGGCGTCGAGGACTTGGAG
GACGCTAAGGAGGGGATTGCCGATTTTGTTATGGCAGAGATGTCTCAGCGGATTCAGTCA
AGCCACAGCATTAGGCAAGACAAGCAGGCGTTGGCAATCGAAAGGGAAAAAGGTAACGAG
GTAATGAAGACAAATGCCCAGTTTTTCAATGCAGTCGAGGGATTTTCCATACTATCGGCA
GTTGGGGCAGTTGATGGTCTATATGTTACAACTCAGCCAAAATTAGGATTGGTACAGGTA
ATCCCTCTCCAAAGAAACTCTTTGCTCCACACTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [9-31]  2.00000075217457e-07 PR00420 [288-303]  2.00000075217457e-07 PR00420
PR00420   RNGMNOXGNASE
IPR006905 Tryptophan halogenase (Family)
 [9-94]  8.30000000000004e-17 PF04820 [99-378]  4.5e-26 PF04820
PF04820   Trp_halogenase
SignalP
 [1-22]  0.852 Signal
Bacteria, Gram-negative   
 [1-22]  0.185 Signal
Eukaryota   
 [1-22]  0.221 Signal
Bacteria, Gram-positive   
TMHMM No significant hit
Crypto_00070 Crypto_00070   last last