close all open/close all

CDS information : Dauno_00010


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction4,087 / 3,224 / - [in whole cluster]
891 / 28 / - [in contig]
Locationcomplement(3224..4087) [in whole cluster]
complement(28..891) [in contig]
TypeCDS
Length864 bp (287 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)ketoreductase
GenedauU
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf1
Reference
ACC
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)
Related Reference
ACC
Q9ZAU1
NITE
Adria_00030
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
Family/Domain
FD
IPR002198

close this sectionSequence

selected fasta
>putative oxidoreductase [ketoreductase]
MTVPTPRHGTPHGGLPGRTVLITGATSGIGRAAALAIARQGARVVLVGRDPERLRTVTNE
VARTAGPAPDAFRADFAELRQVRELGERLRDRYPRIDVMAGNAGGMFWSRTTTQDGFEAT
LQVNHLAGFLLARLLRERLAGGRLILTSSDAYTQGRIDPDDLNGDRHRYSAGQAYGTSKQ
ANIMTATEAARRWPDVLTVSYHPGEVRTRIGRGTVASTYFRFNPFLRSAAKGADTLVWLA
AAPAEELTTGGYYSDRRLSPVSGPTADAGLAAKLWEASAAAVGDTAR
selected fasta
>putative oxidoreductase [ketoreductase]
ATGACGGTCCCCACCCCGCGCCACGGGACACCACACGGCGGCCTGCCGGGCCGGACGGTG
CTGATCACCGGGGCCACGTCCGGCATCGGCCGGGCGGCGGCCCTCGCGATCGCCCGCCAG
GGGGCCCGCGTCGTGCTCGTCGGCCGGGACCCCGAGCGTCTTCGGACCGTCACGAACGAG
GTGGCCCGGACCGCCGGCCCGGCCCCGGACGCCTTCCGCGCGGACTTCGCCGAGCTGCGC
CAGGTACGCGAGCTGGGAGAGCGGCTGCGGGACCGGTACCCGCGCATCGATGTCATGGCC
GGCAACGCCGGCGGCATGTTCTGGTCGCGCACCACGACCCAGGACGGGTTCGAGGCCACC
CTCCAGGTCAATCATCTCGCGGGCTTCCTGCTGGCACGGCTGCTGCGGGAGCGGCTCGCG
GGCGGGCGGTTGATCCTCACCTCGTCCGACGCGTACACCCAGGGCCGGATCGACCCGGAC
GATCTCAACGGCGACCGTCACCGCTACAGCGCGGGCCAGGCGTACGGCACGTCCAAACAG
GCCAACATCATGACCGCCACGGAGGCCGCCCGGCGCTGGCCGGACGTGCTGACGGTCAGC
TACCACCCCGGCGAGGTCCGCACCCGCATCGGGCGGGGCACAGTCGCCTCGACCTACTTC
CGGTTCAACCCCTTCCTGCGGTCCGCGGCCAAGGGCGCCGACACTCTCGTGTGGCTGGCG
GCCGCGCCGGCCGAGGAGTTGACCACGGGCGGCTACTACAGCGACCGGCGGCTGTCCCCG
GTGAGCGGCCCGACCGCCGACGCCGGCCTCGCGGCCAAGCTCTGGGAGGCCAGCGCGGCC
GCCGTCGGCGACACCGCGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [19-155]  8.49999999999995e-20 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [19-36]  7.20000348184352e-08 PR00081 [94-105]  7.20000348184352e-08 PR00081 [136-152]  7.20000348184352e-08 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [8-279]  1.70000000000001e-49 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit