close all open/close all

CDS information : Dauno_00020


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction4,338 / 4,084 / - [in whole cluster]
1,142 / 888 / - [in contig]
Locationcomplement(4084..4338) [in whole cluster]
complement(888..1142) [in contig]
TypeCDS
Length255 bp (84 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)acyl carrier protein
GenedpsG
Gene (GenBank)dauA(g)
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)
[9098068] Minimal Streptomyces sp. strain C5 daunorubicin polyketide biosynthesis genes required for aklanonic acid biosynthesis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

ACP5..77

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
MAELSLAELREIMRQSLGEDEVPDLADADTVTFEDLGLDSLAVLETVNHIERTYGVKLPE
EELAEIRTPHSMLIFVNERLRAAV
selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
ATGGCTGAGCTCAGCCTGGCGGAACTGCGGGAGATCATGCGGCAGAGCCTGGGAGAGGAC
GAGGTCCCCGACCTGGCGGACGCCGACACCGTGACCTTCGAGGATCTCGGGCTCGACTCC
CTGGCCGTCCTGGAAACGGTCAACCACATCGAGCGGACCTATGGCGTGAAGCTGCCCGAG
GAGGAACTGGCGGAGATCAGGACGCCTCACAGCATGCTGATTTTCGTCAACGAGAGGCTG
CGAGCCGCGGTATGA
ACP5..77
ACP13..231

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [35-50]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [6-81]  9.10000000000001e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [8-73]  3.2e-13 PF00550
PF00550   PP-binding
 [1-80]  4.09999599045784e-14 SSF47336
SSF47336   ACP_like
 [5-77]  PS50075
PS50075   ACP_DOMAIN
SignalP
 [1-18]  0.074 Signal
Eukaryota   
 [1-28]  0.08 Signal
Bacteria, Gram-positive   
TMHMM No significant hit