close all open/close all

CDS information : Dauno_00030


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction4,566 / 5,021 / + [in whole cluster]
1,370 / 1,825 / + [in contig]
Location4566..5021 [in whole cluster]
1370..1825 [in contig]
TypeCDS
Length456 bp (151 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf2
Reference
ACC
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)
Related Reference
ACC
Q9ZAT9
NITE
Adria_00050
PmId
[9864344] Doxorubicin overproduction in Streptomyces peucetius: cloning and characterization of the dnrU ketoreductase and dnrV genes and the doxA cytochrome P-450 hydroxylase gene. (J Bacteriol. , 1999)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
ACC
Q53925
NITE
Actino_00020
PmId
[17227452] Possible involvement of ActVI-ORFA in transcriptional regulation of actVI tailoring-step genes for actinorhodin biosynthesis. (FEMS Microbiol Lett. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein
MDALPADDAPTTESADSADPGIYLQVQRFYARQMQLLDDGRAEDWARTFVHDGVFAVGGE
AVRGVADIARAARRTTDRFAAEGITRRHWIGMLTVDGKPDEVTARSYAVVLETPPDGDPV
FRRSTVCTDILVREAGEWRVRHRTVTRDGLD
selected fasta
>hypothetical protein
ATGGACGCGCTTCCGGCGGACGACGCGCCGACGACAGAGTCGGCGGATTCTGCGGACCCC
GGCATTTACCTCCAGGTACAGCGGTTCTACGCCCGTCAGATGCAACTCCTGGACGACGGC
AGGGCCGAGGACTGGGCGCGCACGTTCGTGCACGACGGTGTCTTCGCGGTGGGCGGCGAG
GCCGTACGCGGGGTCGCGGACATCGCGCGTGCGGCACGGCGGACCACGGACCGGTTCGCC
GCCGAGGGGATTACCCGGCGGCACTGGATCGGCATGCTCACCGTCGACGGCAAGCCCGAC
GAGGTCACGGCCCGGAGCTACGCGGTGGTGCTGGAGACGCCGCCCGACGGTGACCCGGTG
TTCCGGCGCAGCACGGTGTGCACGGACATCCTGGTGCGGGAAGCGGGCGAGTGGCGCGTC
AGGCACCGCACCGTCACCCGGGACGGGCTGGATTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit