close all open/close all

CDS information : Dauno_00040


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction5,047 / 6,597 / + [in whole cluster]
1,851 / 3,401 / + [in contig]
Location5047..6597 [in whole cluster]
1851..3401 [in contig]
TypeCDS
Length1,551 bp (516 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)
GenednmT
Gene (GenBank)
EC number
Keyword
  • daunosamine
Note
Note (GenBank)
  • orf3
Reference
ACC
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)
Related Reference
ACC
P95833
NITE
Adria_00060
PmId
[8955419] Enhanced antibiotic production by manipulation of the Streptomyces peucetius dnrH and dnmT genes involved in doxorubicin (adriamycin) biosynthesis. (J Bacteriol. , 1996)
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase
MRRHSAAATTVQIARSVLARDGLCSGMDRFWAWYAERSARVVHRTERIPLDALKGWSRHP
VTGTISHHTGRFFSIEGLDVHIPGAPVPRWSQPIVNQPEVGILGFLVKERGGILHCLVQA
KFEPGNPGGLQLSPTVQATRSNYTRVPGGKTIPSWSTSATPPDRQVVADVLQSGQGSWFY
RKRNRNMIVQVFDEVPLREDFHWLTLGQLHRLLGVENLVNMDARTVLACLPSRARERARW
PTRSPPELTAPGASAHPVVPSLGPTAAGLRWTPGFHHSLVRSCAAAEGSLHSTVDIVSWI
ATCAAGPMWSPARQANSLPHWIERDGVIATRAGRFLEVMAVDVTAASREVPGWSQPMIEP
KGRGVAAFLVRRIDGVLHALGTARVEPGYVDVVEIAPTVQCTPGSLHALPAGARPRFLDA
VLEAPPEAACATTTDLAEEGGRFHHAVNTYMIVEADDDIPDGGEFRWLTLHQLVELLRHS
HYVNVQARTLVACLHSLSVGHRPSTRSAVPSAPPRR
selected fasta
>putative NDP-hexose 2,3-dehydratase
GTGCGCCGGCACAGTGCTGCCGCGACGACCGTCCAGATCGCCCGCTCCGTCCTCGCCCGG
GACGGCCTGTGCAGCGGCATGGACCGGTTCTGGGCGTGGTACGCCGAGCGCTCGGCGCGG
GTGGTGCACCGCACCGAGCGGATTCCGCTGGATGCCCTCAAGGGGTGGAGTCGCCACCCG
GTCACCGGGACCATCTCCCATCACACCGGAAGGTTCTTCAGCATCGAGGGACTGGACGTG
CACATTCCGGGCGCCCCGGTGCCACGCTGGTCCCAGCCGATCGTGAACCAGCCCGAAGTG
GGCATCCTGGGCTTCCTGGTGAAGGAACGCGGCGGGATCCTCCACTGCCTCGTCCAGGCC
AAGTTCGAGCCGGGCAACCCCGGCGGACTTCAGCTCTCCCCCACGGTCCAGGCCACACGG
AGCAACTACACGCGGGTGCCCGGCGGCAAGACCATCCCGTCCTGGAGCACTTCCGCGACA
CCTCCGGACCGGCAGGTGGTCGCCGATGTGCTCCAGTCGGGACAGGGCTCCTGGTTCTAC
CGCAAACGCAACCGCAACATGATCGTCCAGGTGTTCGACGAGGTCCCGCTGCGCGAGGAC
TTCCACTGGCTCACGCTGGGTCAGCTGCACCGGCTGCTGGGGGTCGAGAACCTCGTGAAC
ATGGACGCCAGGACGGTGCTGGCCTGCCTGCCGTCGCGAGCGAGGGAGCGCGCCCGCTGG
CCGACGCGGAGCCCGCCGGAGCTGACGGCCCCGGGGGCGTCAGCCCACCCCGTGGTCCCC
TCGCTCGGCCCGACGGCGGCGGGTCTCCGGTGGACGCCCGGTTTCCACCACTCCCTCGTG
CGATCGTGCGCGGCGGCCGAGGGCAGCCTGCACAGCACGGTGGACATCGTCAGCTGGATC
GCGACCTGCGCAGCCGGACCGATGTGGTCACCCGCCCGACAGGCTAACTCGCTGCCGCAC
TGGATCGAGCGGGACGGCGTGATCGCCACGAGAGCCGGGCGCTTCCTGGAGGTGATGGCC
GTGGATGTGACGGCCGCCTCGCGAGAGGTGCCCGGCTGGAGTCAGCCGATGATCGAACCC
AAGGGCCGAGGGGTCGCGGCCTTCCTGGTCCGGCGGATCGACGGGGTTCTCCACGCCCTC
GGGACCGCGCGCGTGGAGCCCGGCTACGTCGACGTGGTGGAGATCGCGCCGACCGTGCAG
TGCACCCCCGGCAGTCTGCACGCCCTGCCGGCCGGAGCCAGGCCCCGCTTCCTCGACGCC
GTCCTGGAGGCGCCCCCCGAAGCAGCGTGCGCTACGACGACCGACCTCGCGGAGGAGGGA
GGACGCTTCCACCACGCGGTGAACACTTACATGATCGTCGAAGCCGACGATGACATCCCG
GACGGTGGTGAGTTCCGGTGGCTGACGCTCCACCAACTCGTCGAGCTGCTGCGTCACTCC
CACTACGTCAACGTCCAGGCCCGCACCCTGGTCGCCTGCCTGCACAGCCTGTCCGTGGGC
CACCGCCCGTCGACCCGCTCGGCCGTGCCGTCCGCCCCGCCTCGGAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [28-230]  1.29999999999998e-75 PF03559 [291-494]  4.80000000000003e-69 PF03559
PF03559   Hexose_dehydrat
SignalP
 [1-19]  0.934 Signal
Bacteria, Gram-negative   
 [1-19]  0.827 Signal
Eukaryota   
TMHMM No significant hit