close all open/close all

CDS information : Dauno_00050


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction6,604 / 7,932 / + [in whole cluster]
3,408 / 4,736 / + [in contig]
Location6604..7932 [in whole cluster]
3408..4736 [in contig]
TypeCDS
Length1,329 bp (442 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)dauH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)
Related Reference
ACC
P95834
NITE
Adria_00070
PmId
[8955419] Enhanced antibiotic production by manipulation of the Streptomyces peucetius dnrH and dnmT genes involved in doxorubicin (adriamycin) biosynthesis. (J Bacteriol. , 1996)
[23885759] Nitrososynthase-triggered oxidative carbon-carbon bond cleavage in baumycin biosynthesis. (J Am Chem Soc. , 2013)
ACC
Q9ZGH7
NITE
Pikro_00090
PmId
[15161264] Characterization of the glycosyltransferase activity of desVII: analysis of and implications for the biosynthesis of macrolide antibiotics. (J Am Chem Soc. , 2004)
[15358425] New olivosyl derivatives of methymycin/pikromycin from an engineered strain of Streptomyces venezuelae. (FEMS Microbiol Lett. , 2004)
[20695498] Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII in the methymycin/picromycin biosynthetic pathway. (Biochemistry. , 2010)
[23770075] Combinatorial biosynthesis and antibacterial evaluation of glycosylated derivatives of 12-membered macrolide antibiotic YC-17. (J Biotechnol. , 2013)
[26552796] In vivo investigation to the macrolide-glycosylating enzyme pair DesVII/DesVIII in Saccharopolyspora erythraea. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative glycosyltransferase [glycosyltransferase]
MRVLFATMAARSHVYAQVTLASALRTAGHEVLVASQPDVLDDIVRAGLTRVRIGEDLNIE
EETREANASFEDDRNLGGLAMSNTRDDPLPWDHALGMFTAMTAMVFQNVCPEPMVDDLVG
LARDWRPDLVVWDPLTLAGPVAARLSGAAHARLLFGPDQMGRNRTAFRALLDRQRPSCVT
TRCAEWLTWTLERWRRQRLDMSEELVLGQWTIDPTPPSMRIPLDLPCVPVRYVPYNGPSL
LPDWLREPPRHPRRLCLTLGVSLGEATGAGTVAASDVLAAVDGLDVEVVATLSRNCQELG
TLPANVRAVDFVRLNALLPSCSGIIHHGGSGTFMTALAHATPQLIVPDMMWDAMEKAHGL
ARSGAGGYVDAKDVSPDLLRERVLDLFDDPSYAAGARRVRAEIVGTPSPNDIVPVLERLT
AEHQAGGPERSPALKSPSTGGA
selected fasta
>putative glycosyltransferase [glycosyltransferase]
GTGCGCGTCCTGTTCGCCACCATGGCCGCGCGGTCCCACGTCTACGCCCAGGTCACCTTG
GCGTCGGCACTGCGGACCGCGGGGCACGAGGTGCTCGTGGCCAGCCAGCCCGACGTCCTC
GACGACATCGTCCGGGCCGGTCTCACGCGCGTGCGGATCGGAGAGGACCTCAACATCGAG
GAGGAGACCCGGGAGGCCAACGCCAGCTTCGAGGACGACCGCAACCTCGGCGGCCTCGCT
ATGAGCAACACCCGTGACGATCCCTTACCGTGGGACCACGCCCTCGGCATGTTCACCGCG
ATGACCGCCATGGTCTTCCAGAACGTGTGCCCCGAACCCATGGTCGACGACCTCGTCGGC
CTCGCCCGCGACTGGCGGCCGGACCTCGTGGTCTGGGATCCGCTGACCCTGGCCGGACCG
GTGGCAGCCCGGCTCAGCGGCGCGGCACACGCCCGGCTGCTGTTCGGCCCGGATCAGATG
GGCCGGAACAGGACGGCGTTCCGCGCCCTGCTCGACCGGCAACGCCCGAGCTGCGTGACG
ACCCGCTGCGCCGAGTGGCTCACCTGGACGCTGGAGCGGTGGCGGCGGCAGCGCCTGGAC
ATGAGCGAGGAACTGGTGCTCGGGCAGTGGACGATCGACCCCACACCACCGTCCATGCGC
ATTCCCCTGGACCTGCCCTGCGTGCCGGTGCGCTACGTGCCGTACAACGGGCCCTCCCTG
CTTCCCGACTGGCTGCGCGAGCCGCCCCGCCACCCGCGGCGCCTGTGCCTGACGCTCGGT
GTGTCCCTCGGCGAGGCGACGGGCGCCGGTACGGTCGCCGCCTCCGACGTCCTGGCAGCC
GTGGACGGCCTGGACGTGGAGGTCGTCGCCACCCTGTCGCGGAACTGCCAGGAACTCGGC
ACCCTGCCGGCGAACGTACGGGCGGTGGACTTCGTCCGGTTGAACGCCCTGCTGCCGTCC
TGCTCGGGCATTATCCATCACGGCGGGTCCGGCACGTTCATGACGGCCCTGGCGCACGCG
ACGCCGCAGCTGATCGTGCCCGACATGATGTGGGACGCCATGGAGAAGGCACACGGCCTG
GCCCGCAGCGGTGCGGGCGGTTACGTGGACGCGAAGGACGTCTCGCCCGACCTGCTGCGT
GAGCGCGTCCTCGACCTGTTCGACGATCCGTCCTATGCCGCCGGGGCACGCCGTGTGCGC
GCCGAGATCGTCGGAACGCCGAGCCCGAACGACATCGTGCCCGTGCTGGAACGGCTGACC
GCCGAGCACCAGGCCGGCGGGCCGGAGCGGAGCCCGGCGCTCAAGTCGCCTTCCACCGGC
GGTGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-64]  6.50000000000001e-09 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [212-307]  1.3e-30 PF06722
PF06722   DUF1205
SignalP
 [1-16]  0.933 Signal
Eukaryota   
 [1-16]  0.578 Signal
Bacteria, Gram-negative   
TMHMM No significant hit