close all open/close all

CDS information : Dauno_00060


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction7,942 / 8,697 / + [in whole cluster]
4,746 / 5,501 / + [in contig]
Location7942..8697 [in whole cluster]
4746..5501 [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productaklaviketone C-7 ketoreductase
Product (GenBank)aklaviketone reductase
Gene
Gene (GenBank)dauE
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>aklaviketone C-7 ketoreductase [aklaviketone reductase]
MENTQRSVIVTGGGSGIGRAVARAFAARGDRVLVVGRTAGPLAETVDGHKEAHTLAVDIT
DPAAPQAVVREVRERLGGVVDVLVNNAATAVFGHLGELDRTAVEAQVATNLVAPVLLTQA
LLDPLETASGLVVNIGSAGALGRRAWPGNAVYGAAKAGLDLLTRSWAVELGPRGIRVIGV
APGVIETGAGVRAGMSQEAYDGFLEAMGQRVPLGRVGRPEDVAWWVVRLADPEAAYASGA
VLAVDGGLSVT
selected fasta
>aklaviketone C-7 ketoreductase [aklaviketone reductase]
ATGGAGAACACACAGCGATCCGTGATCGTGACCGGCGGCGGCTCCGGCATCGGACGAGCC
GTCGCCCGCGCTTTCGCCGCCCGGGGCGACCGCGTCCTCGTCGTGGGTAGGACCGCCGGT
CCGCTGGCCGAGACGGTCGACGGGCACAAGGAGGCGCACACGCTGGCCGTGGACATCACC
GACCCCGCAGCGCCGCAGGCCGTCGTCCGGGAGGTGCGCGAGCGGCTCGGCGGCGTGGTC
GACGTGCTCGTGAACAATGCCGCCACTGCCGTCTTCGGGCACCTGGGGGAGCTGGACCGC
ACCGCGGTGGAGGCGCAGGTGGCCACGAACCTCGTGGCCCCCGTGCTGCTGACCCAAGCA
CTGCTCGACCCCCTGGAGACCGCCTCCGGGCTGGTCGTGAACATCGGTTCGGCGGGCGCG
CTGGGCCGGCGGGCCTGGCCGGGGAACGCGGTGTACGGAGCGGCCAAGGCCGGGCTGGAC
CTGCTGACGCGGTCCTGGGCCGTGGAACTCGGCCCCCGCGGAATTCGCGTGATCGGGGTC
GCCCCGGGAGTGATCGAGACGGGCGCGGGAGTCCGGGCCGGGATGTCCCAGGAGGCGTAC
GACGGGTTCCTGGAAGCCATGGGACAACGCGTCCCGCTCGGCCGGGTGGGCCGGCCCGAG
GACGTCGCGTGGTGGGTGGTGCGGCTCGCCGATCCCGAAGCCGCGTACGCCAGCGGTGCC
GTGCTCGCCGTGGACGGGGGGCTGTCGGTGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [78-89]  1.29999924468179e-09 PR00080 [130-138]  1.29999924468179e-09 PR00080 [152-171]  1.29999924468179e-09 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [7-24]  8.90000829418047e-36 PR00081 [78-89]  8.90000829418047e-36 PR00081 [124-140]  8.90000829418047e-36 PR00081 [152-171]  8.90000829418047e-36 PR00081 [173-190]  8.90000829418047e-36 PR00081 [212-232]  8.90000829418047e-36 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [4-250]  5.69999999999998e-71 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-26]  0.522 Signal
Bacteria, Gram-positive   
TMHMM No significant hit