close all open/close all

CDS information : Dauno_00080


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction18,433 / 17,771 / - [in whole cluster]
1,163 / 501 / - [in contig]
Locationcomplement(17771..18433) [in whole cluster]
complement(501..1163) [in contig]
TypeCDS
Length663 bp (220 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productaklanonic acid O-methyltransferase
Product (GenBank)aklanonic acid methyltransferase
Gene
Gene (GenBank)dauC
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[7836284] Analysis of clustered genes encoding both early and late steps in daunomycin biosynthesis by Streptomyces sp. strain C5. (J Bacteriol. , 1995)
Related Reference
ACC
Q54818
NITE
Adria_00310
PmId
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)

close this sectionSequence

selected fasta
>aklanonic acid O-methyltransferase [aklanonic acid methyltransferase]
MQDSSYKKQVTQAFDQSSSTYDRLGVEFFTPMGRRLVDISEPVTGERVLDIGCGRGACLF
PAAEKVGSQGCVHGIDIAPGMIEEARKEATERGLRNISLMVMDAETPGFPARSFDLVMGS
YSVIFLPDAVGALARYADILDHGGRIAFTSPVFRAGTFPFLPPEFTPLIPQALLEHLPEQ
WRPEALVRRFNSWLERAEDLVRTLEGCGYARLRQSTSRCG
selected fasta
>aklanonic acid O-methyltransferase [aklanonic acid methyltransferase]
GTGCAGGATTCGTCCTACAAGAAACAGGTGACTCAGGCCTTCGACCAGTCGTCGTCCACT
TATGATCGACTGGGGGTGGAATTCTTCACGCCCATGGGTCGCCGCCTGGTGGACATCTCG
GAGCCGGTCACGGGTGAACGAGTGCTCGACATCGGCTGCGGGCGCGGCGCATGCCTTTTC
CCGGCTGCGGAAAAGGTCGGCTCCCAGGGGTGCGTCCACGGTATCGACATCGCTCCCGGA
ATGATCGAGGAAGCTCGCAAGGAAGCCACCGAACGCGGTCTGCGGAATATCAGCCTCATG
GTGATGGATGCGGAGACACCCGGATTTCCGGCGCGTTCCTTCGACCTGGTCATGGGGAGC
TACAGCGTCATTTTCCTGCCGGATGCCGTGGGGGCCCTCGCGCGCTACGCCGACATCCTG
GACCACGGCGGCAGGATCGCGTTCACCAGCCCGGTCTTCCGTGCCGGCACGTTCCCGTTC
CTGCCGCCGGAGTTCACCCCGCTCATCCCCCAGGCATTGCTGGAGCACCTCCCCGAGCAG
TGGCGGCCCGAGGCGCTGGTCCGGCGGTTCAACAGCTGGCTGGAGCGAGCCGAGGATCTT
GTCCGTACCCTTGAAGGCTGCGGTTACGCTCGTCTCCGTCAGTCGACGAGCCGGTGCGGA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit