close all open/close all

CDS information : Dauno_00090


close this sectionLocation

Organism
StrainC5
Entry nameDaunorubicin
Contig
Start / Stop / Direction18,623 / 19,108 / + [in whole cluster]
1,353 / 1,838 / + [in contig]
Location18623..19108 [in whole cluster]
1353..1838 [in contig]
TypeCDS
Length486 bp (161 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productaklanonic acid methyl ester cyclase
Product (GenBank)
Gene
Gene (GenBank)dauD
EC number
Keyword
  • 4th ring
Note
Note (GenBank)
  • putative
Reference
ACC
PmId
[7836284] Analysis of clustered genes encoding both early and late steps in daunomycin biosynthesis by Streptomyces sp. strain C5. (J Bacteriol. , 1995)
Related Reference
ACC
Q54808
NITE
Adria_00320
PmId
[7601857] Functional characterization and transcriptional analysis of a gene cluster governing early and late steps in daunorubicin biosynthesis in Streptomyces peucetius. (J Bacteriol. , 1995)
[10200167] DnrD cyclase involved in the biosynthesis of doxorubicin: purification and characterization of the recombinant enzyme. (Biochemistry. , 1999)

close this sectionSequence

selected fasta
>aklanonic acid methyl ester cyclase
MSPQIDLVRRMVEAYNTGKTDDVAEFILHEYLNPGALEHNPELRGPEAFAAAVTWLKYAF
SEEAHLEEIGYEENGPWVRAKLALYGRHVGNLVGMPATGRRFSGEQIHLIRIVDGKIRDH
RDWPDYLGTYRQLGEPWPTPEGWRPCPPPPRRRHDRSTDTP
selected fasta
>aklanonic acid methyl ester cyclase
ATGAGCCCGCAGATCGATCTGGTCCGCCGCATGGTGGAGGCGTACAACACGGGAAAAACC
GATGATGTCGCGGAGTTCATTCTACACGAGTACCTGAACCCCGGCGCGCTGGAGCACAAC
CCGGAGCTGCGAGGCCCGGAGGCGTTCGCAGCTGCCGTCACGTGGCTCAAGTACGCCTTC
TCCGAGGAGGCGCACCTGGAGGAGATCGGGTACGAGGAGAACGGCCCGTGGGTCCGCGCG
AAGCTCGCCCTCTACGGGCGGCACGTCGGCAACCTCGTCGGCATGCCGGCAACGGGGCGC
CGGTTCTCCGGTGAGCAGATCCACCTCATCCGCATCGTCGACGGCAAGATCCGTGATCAC
CGCGACTGGCCCGACTATCTCGGCACCTACCGCCAGCTCGGCGAGCCCTGGCCCACTCCC
GAGGGCTGGCGACCCTGCCCCCCACCGCCCCGCCGACGCCACGACAGGAGCACGGACACA
CCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [6-133]  9.50000000000005e-33 PF07366
PF07366   SnoaL
SignalP No significant hit
TMHMM No significant hit